KEGG   Thermoanaerobacter tengcongensis: TTE0188Help
Entry
TTE0188           CDS       T00081                                 

Gene name
AceF
Definition
dihydrolipoamide acyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TTE0188 (AceF)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTE0188 (AceF)
   00020 Citrate cycle (TCA cycle)
    TTE0188 (AceF)
   00620 Pyruvate metabolism
    TTE0188 (AceF)
Enzymes [BR:tte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TTE0188 (AceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
191694..192938
Genome map
AA seq 414 aa AA seqDB search
MANVKLMPKLGMTMTAGKVVRWLKKEGEKVEAGEPLLEIETDKVTMEEEAGYTGTLLKIL
VREGEEVPINQPIAIIGGEGEDIEEILKTLKVSEGVEEEKKEEKIKVKIEEKPEEVKREE
ISKPRATPAARKIAREHGIDLSEVIGSGAHGRIHRKDVEEYIRKRTEIVPSQVTVEQKVE
KKEEIPSYRVIPFTGMRKIIAEKMQKSINTAPHFYVTMEVKMREILKLRETLNSKLKEDE
AKISLNTLLMKAAGIAIKDYPIFNSYVEEGQIILRNEINIGLAVALDEGLIVPVIREVDK
KGLKEIAREEKALIQKAREGKLTPDEYTGGSFTISNLGMFDVVRFAAIINPPEVAILAVG
KIREIPVVEEGQIEIEPIMEMTLSSDHRVIDGALAAKFLRRIKEILEDPLQFML
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgtaaaacttatgcctaagttaggtatgactatgacagctggcaaagtagtt
agatggttgaaaaaagaaggtgaaaaagtagaagcaggagagcctcttttggaaatagaa
actgacaaagttacaatggaagaagaagcaggttacacagggactcttttaaaaattctt
gtaagagagggagaagaagttcctataaatcagcctatagctataataggaggagaagga
gaagacatagaagagatactaaaaacgttaaaagtctctgagggagttgaagaagagaaa
aaagaagagaagataaaagtaaaaatagaggagaagccagaagaggtgaaaagagaagaa
atatctaaaccaagagctacaccggcagcaaggaaaatagcaagggaacatgggatagac
ctgtcagaagtaataggctctggagctcacggcagaattcataggaaagatgtagaagaa
tatattagaaagcgtactgaaatagtgccttcacaagtaacagtagaacaaaaagtagag
aaaaaagaagaaataccctcttatagagttattcctttcacaggaatgagaaaaataata
gcagaaaaaatgcaaaaaagtataaatacagctcctcatttttatgttactatggaagta
aagatgagagaaattttaaaattgagagagacattaaatagtaaattgaaagaggatgaa
gcaaaaattagccttaataccctgcttatgaaagctgctggaatagcaataaaagattat
ccgatatttaattcttatgtagaggaaggccagataattttaaggaatgaaataaatata
ggattggcggtagctttggatgaaggactaattgtacctgttataagggaagtagacaaa
aaaggattgaaagaaatagcaagggaagaaaaagcacttattcagaaagcaagagaagga
aaattaacacctgatgagtatactggaggaagtttcacaatctctaatttaggtatgttt
gatgtagtaagatttgcagctataattaatccaccggaagtagcaattttagctgtaggg
aagataagagagattcccgttgtagaagaaggacaaatcgaaatagagccgataatggaa
atgactttatcttcagatcatagagtaatagacggtgctctcgcggctaaatttttgaga
aggataaaagaaattttagaagatcccttacaatttatgttgtaa

DBGET integrated database retrieval system