KEGG   Thermoanaerobacter tengcongensis: TTE0202Help
Entry
TTE0202           CDS       T00081                                 

Gene name
RbsK
Definition
ribokinase family sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TTE0202 (RbsK)
Enzymes [BR:tte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TTE0202 (RbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
208536..209456
Genome map
AA seq 306 aa AA seqDB search
MRKIVVVGSINMDIVIRVPRIPVVGETVIAYDLKNYGGGKGANQAVSIARLGGNVSMIGR
VGNDEYGQKLYRDLKSNGVGVEGIEFDSETPTGTAYINVSEKGENNIVVYQGANKRLNMT
QIKRYEHFFDEAEICLLQLEIPIETVKFVVDLCYSRGIKVILNPAPAYELPDTVLEKVYI
LTPNETELAFLSKSKIETIEDIRKASKYLLDKGVQNVITTIGEKGSYFINKNTEKLFDAI
KVTAVDTTAAGDSFTGALAFALSKGEKIEDAIRFATFVAALTVTKEGAQTSLPYKEEVEK
FIKERS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatagttgttgtaggaagcattaacatggatattgtaataagagtaccgcgc
attccagttgttggagagacagttattgcttacgatttaaaaaattatggtggtggtaaa
ggtgcaaaccaggctgtatctatagctaggttaggtggaaatgtttctatgattggtcga
gtaggaaatgatgagtatggccaaaaattatatagggatttaaaaagcaatggggtaggt
gtagaaggaatagaatttgattcagagactcccacaggtacagcatatattaacgtgagt
gaaaaaggagaaaacaatatagtagtttatcagggtgcaaacaagaggcttaatatgaca
caaataaaaagatatgagcatttttttgatgaagcagaaatatgtcttcttcaattagaa
ataccaattgaaacagtgaagtttgtagtagatttgtgctatagcagagggataaaagtt
atattaaatcctgcaccagcatacgaattgcctgatacagttttagagaaagtttatatt
ttgactccaaatgaaacagagttagcttttttatccaaaagcaaaatagaaacaattgaa
gatataagaaaggcttcgaaatatttgctagacaaaggagttcaaaatgttataacaact
attggagaaaaaggaagttattttattaataaaaatacggaaaaactatttgatgcaatt
aaagttactgctgttgatacaacagcagcaggtgattcatttacaggagcgttagctttt
gctttaagcaaaggggaaaaaatagaggatgcaataagatttgctacatttgttgctgca
cttacagttactaaagaaggtgcccagacttctttgccttataaagaagaagtagaaaaa
tttattaaggagaggagttga

DBGET integrated database retrieval system