KEGG   Thermoanaerobacter tengcongensis: TTE0215Help
Entry
TTE0215           CDS       T00081                                 

Gene name
BglX
Definition
beta-glucosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tte00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:tte00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
221759..223339
Genome map
AA seq 526 aa AA seqDB search
MKKIEEMTLEEKIGQMLMIGFPSAFYDDHIRELVTSYKIGNVILFSRNVQDARQVMDLCT
DIQKEAIENTGIPAFISIDQEGGMVTRIYRGATYFPGNMAIGATKDPENAYKVGEIAGRE
LRTIGININFAPVMDVNNNPLNPVIGVRSYGENPEDVANFGINYIKGLQKEGVIATAKHF
PGHGDTTVDSHLDLPKVNHGKDRLYEVELYPFKKAVENGVDAIMTAHILFPALEDSKVPA
TLSYNILTRILREEFKFDGLVITDCMEMNAIAKYFGTQKAASMAIKAGADIVLVSHTKEL
QIKAFENIKEAVERGDISVERIDESVRRILKMKEKYGLFDRPYPEKDKFDTTVGIEKHRK
IAKAISLKSITVVKDEKKLIPLKTKNVLAISPETVPVSFVDDALMDRLSFARQFTSTFGG
VEETISVNPNNREISVILEKAKDKEVVVVGTYNANLNEGQVKLVNALLQVNKNVIVVALR
NPYDLQKFENVPTYVCAYEYTPLSVESVIGVLTGKYPAEGKLPVTI
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatagaagaaatgacattggaagaaaaaatagggcaaatgctgatgataggt
tttccgtcagctttttacgacgaccatataagagaattagtaacaagttataaaataggg
aatgtaatactcttttcaagaaatgtgcaggatgcaaggcaagtaatggatttatgcact
gacatacagaaagaagcaatagaaaataccggaataccagcttttatctctattgaccag
gaaggtggcatggtcacaaggatttacagaggagctacttattttcccggcaatatggct
attggtgctacaaaagacccagaaaatgcttataaagtgggagaaatagctggaagagaa
ttaagaactataggcataaacataaatttcgctccggttatggatgtgaacaataaccct
ttaaatccagtgataggagtcaggtcttacggtgaaaacccagaggatgtggctaatttt
ggaataaactacataaaagggcttcaaaaagaaggtgtgatagctacagctaaacatttc
ccaggacatggagacacaactgtggattctcaccttgatttaccgaaagtcaatcatggc
aaggataggctttatgaagtggaattatatccgtttaagaaagctgtagaaaatggcgta
gatgcgataatgacagctcatatactttttccggctttagaagatagtaaagttcctgca
actctttcttataatatccttacccgcatcttaagggaagaattcaagtttgatgggctt
gttataactgactgtatggaaatgaatgcgatagccaaatattttggcactcaaaaggca
gcgtcaatggctataaaagctggagcagatatagtacttgtttctcatactaaagagcta
cagataaaagcttttgaaaatataaaagaagctgtagaaagaggagatatctctgtagaa
agaatagatgaatcagtaagaaggatactcaagatgaaagaaaaatatggactttttgat
aggccatatcctgagaaagacaaatttgacaccacagttggaattgagaaacatagaaaa
attgcaaaagccataagtttaaagagcataacagttgttaaagatgagaaaaaattaatc
cctttaaagacgaaaaatgtactggcaatttctcctgaaacagttccggtttcttttgta
gacgatgctttgatggataggctttcttttgcaagacaatttacttctacatttggagga
gtagaagaaactatttctgtaaatccaaacaatagagaaatctcagtaattctagaaaag
gcaaaggataaagaagtagttgtcgtaggtacttacaatgctaatttaaatgaaggtcaa
gtaaaactagtaaacgcacttttgcaagtgaacaaaaatgtaattgttgtagctttgaga
aatccttatgaccttcaaaagtttgaaaatgtgcctacttatgtatgtgcttacgagtac
accccattgtcagtagaaagcgtgataggagtcttgacggggaaatatcctgctgaagga
aaacttcctgtgaccatatga

DBGET integrated database retrieval system