KEGG   Thermoanaerobacter tengcongensis: TTE0241Help
Entry
TTE0241           CDS       T00081                                 

Gene name
BglX2
Definition
beta-glucosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TTE0241 (BglX2)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    TTE0241 (BglX2)
Enzymes [BR:tte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TTE0241 (BglX2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
246704..248479
Genome map
AA seq 591 aa AA seqDB search
MGCSVSRRNSMRKVIIVFLVLITLLFLFLYLHPADKRNHSEKDPIDELIKNMTVEEKIGQ
MLMPAIDGTKATPQLEKMIKDYHLGGVILFSENIQSIEQIVKLTNDIQSLSLQIPLFIST
DQEGGLVYRLSQGTKFPGNMALGATFSEDLAYKVGKVIGSELKAVGINWDLAPVMDVNVN
PYNPVIGIRSFGGNPDVVAKLGVAFMKGLQENKIASCVKHFPGHGDVDVDSHLGLGTVNK
NRETLEKIELKPFEEAIQAGTDALMTAHLSFPALDDTKVIAKTSEGVQKEITIPATLSHK
ILTDLVRKTWGYEGVIITDAMNMKAISDNFGPVDAVVRAVKAGADIILMPVDLNGAFNEL
VLETKKGIISEKRIDDSVRRILKLKYKLGLMETKDIDLENMIQQARAIVGNEKNLLVEKE
VAERSITLLRNSGNLLPLGKETLNKKILIIGGTKDLVNGFVNELKKYHPGNNAFLVINNG
TLRGSGSLTSDLKKAIDGSDIVILMTNNIMSPNSLAEKIVNYGGDKVIGIAVRNPYDIMY
YPQVKVYLVQYGWNPCSIKAMVDVLFGAVNPTGKLPVEIPGLYPIGYGLSY
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgggatgttctgtaagcaggaggaatagtatgagaaaagtaataattgtttttctagta
ttgataactctgttatttctttttttatatttacatcctgcagacaaacggaatcattct
gaaaaagatccaatagatgaattgataaaaaatatgactgtggaagaaaaaataggacaa
atgcttatgcctgcaatagacggtacaaaagcgactccccagttagagaaaatgattaag
gattaccatttgggtggtgtaatattattttcggaaaatatacaaagtatcgaacaaatt
gtgaagttaacaaatgacatacagagtttgtcactccaaattccgttatttataagtact
gatcaagaaggtgggttagtttatcgcctttcacaagggacaaaatttccaggcaatatg
gctttaggtgcgaccttttctgaagatttggcttataaagttgggaaagttattggaagt
gaattaaaggctgtggggattaattgggatttagcgcctgtcatggatgttaatgtaaac
ccatacaatcctgttataggtataaggtcgtttggtggtaatccagacgtggtggctaaa
ctaggtgttgcttttatgaaaggacttcaggaaaataaaattgcgtcctgtgtaaaacat
tttcctggacatggagatgttgatgtagattctcatttaggattggggactgtcaataaa
aatagagagactttagaaaaaatagagttgaaaccttttgaggaagcaattcaggcaggg
acagatgctttaatgacagcgcatttgagttttcctgcattagatgatactaaagttata
gcaaaaacttcagaaggtgttcaaaaggaaatcactattcctgctactctttctcacaag
attttaactgatcttgtaagaaagacctggggttacgaaggcgtaattataacagatgca
atgaatatgaaggcaatttctgataattttgggccagtagatgctgtagttagagctgtc
aaagctggagcggatataattctcatgcctgtagatttaaatggcgctttcaatgaatta
gtcttagagacgaaaaagggcataatatcagagaagaggattgacgattcggtaaggaga
attttgaaacttaaatataagttaggattaatggaaacaaaagatatagatttggaaaat
atgattcagcaggcaagagctatagttggaaatgaaaaaaacttgttagtagaaaaagag
gtggctgagaggtctataactttattaagaaatagtggtaatttgctacctttaggcaaa
gagacattaaacaagaaaatcttgataattggcggtactaaggacctggtcaatggtttt
gtaaatgagctaaaaaaatatcacccaggaaataacgcatttttagtgataaataacgga
accctaaggggttctggaagtttaacttcagatctaaaaaaagcaatagacggctctgac
atagtgattcttatgacaaataatattatgtctccaaacagtttagctgagaagatagta
aattatggaggagataaggtaattggaatagcagtaagaaatccctatgatatcatgtat
tatcctcaggtgaaagtctatttagttcaatacggttggaatccatgtagtattaaggcc
atggtagatgtattatttggtgctgtaaatcctacagggaaattacctgtagaaattcct
gggttgtatccaattgggtatggattgagttattag

DBGET integrated database retrieval system