KEGG   Thermoanaerobacter tengcongensis: TTE0285Help
Entry
TTE0285           CDS       T00081                                 

Definition
(RefSeq) hypothetical protein
  KO
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TTE0285
   01230 Biosynthesis of amino acids
    TTE0285
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTE0285
   00030 Pentose phosphate pathway
    TTE0285
   00051 Fructose and mannose metabolism
    TTE0285
  Energy metabolism
   00680 Methane metabolism
    TTE0285
Enzymes [BR:tte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     TTE0285
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     TTE0285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
298118..299206
Genome map
AA seq 362 aa AA seqDB search
MSKITLSVIKADIGGYVGHTDVHPDLLEIAKKMLKEKGDMLIDFHVTRVGDDIQLIMTHR
EGVDSEKIHKLAWDTFLACTERARELKLYGAGQDLLKDSFSGNIKGMGPGVAEMEFEERK
SEPVVIFIADKTEPGAWNLPLYKMFADPFNTAGLIIDPSMHQGFKFEVYDMYEGKKIVFN
TPEELYDMLVFIGATGRYCIRKVYTKNNEIAAVSSTQRMNLMAGKYIGKDDPVLIVRCQN
GLPAVGEVLEAFANPHLVFGWMRGSHTGPMIPVSLEDAVPTRFDGPPRVCALGFQLKEGK
LIGPQDLFKDIAFDSARKKALEIADYMRTLGPFEPHRLPLQELEYTTLPHLMEKLKDRWE
KD
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaatcaccctatcagttatcaaagcggatatcggcggatatgtagggcataca
gatgttcatccagaccttttagaaattgccaaaaaaatgctgaaagaaaaaggtgatatg
ctaattgattttcatgttacaagagttggggacgacatacagctcataatgactcacaga
gaaggagtggacagtgaaaaaattcataaattagcctgggacacttttctagcatgtaca
gaaagggcaagggaattaaagctatacggtgcagggcaagacctattaaaagattctttt
tctggcaatataaaaggtatgggacctggtgttgcagagatggaatttgaagagagaaaa
agtgagcctgtggtgatatttattgcagataaaactgagccgggagcttggaatttgcct
ctttacaagatgtttgctgaccctttcaacactgcagggcttataattgacccttcaatg
catcaggggtttaaatttgaggtttatgatatgtatgaagggaaaaaaatagtttttaac
actccagaagagctttatgatatgcttgttttcataggggcgacggggagatattgtata
agaaaagtgtatacaaaaaacaatgaaatagcagcagtttcttccactcaaaggatgaat
ttgatggcagggaaatacatagggaaagatgaccctgtgctcattgtgaggtgccagaat
ggacttcctgctgtgggagaggttttagaagcctttgcaaaccctcaccttgtttttgga
tggatgagagggtctcacactggccctatgattcctgtatctttggaggatgcagttcct
accagatttgacgggcctcctagagtgtgcgctctgggatttcaattaaaggaagggaag
ttgataggaccacaagacctctttaaagacatagcctttgacagcgctaggaagaaagca
ttagaaatagcagattacatgagaactctggggccctttgaacctcacagattgccactt
caggaactggagtatactactttacctcatctaatggaaaaattgaaggacaggtgggag
aaggactaa

DBGET integrated database retrieval system