KEGG   Thermoanaerobacter tengcongensis: TTE0338Help
Entry
TTE0338           CDS       T00081                                 

Gene name
BglB
Definition
Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTE0338 (BglB)
Enzymes [BR:tte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     TTE0338 (BglB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
357649..359043
Genome map
AA seq 464 aa AA seqDB search
MSKEYRFPEGFWWGSATSAVQIEGAADEDGKGMNVWDYWYQKEPNRFFNGIGSQVTSDFY
HRYKEDIKLMKELGHNSFRFSISWSRLIPGGTGKVNEKAVEFYNNVINELLENGIEPFAT
LFHFDMPIEMQNIGGFENRKVVEYFAEYAKTCFELFGDRVKRWITFNEPIVPVLGGYLYN
FHYPDIVDFKRAVQFGYGTVLASARAIEEFKKLKINDAKIGIVLNLSPVYPRSNHPADLK
AAELADLFHNRSFLDPSVKGEYPKELVEVLKAYNHLPEYKEEDLELIKDNTVQYLGVNYY
QPLRVKAKENMPNPYGVFTPNWFYDEYIMPGRRMNPYRGWEIYEKGIYDLLKRIKDEYGN
IECFISENGMGVEGEERFIKDGIIQDDYRIEFIKEHLKWVHKAIEEGCNVKGYHVWTFMD
NWSWLNAYKNRYGLVAIDLKTQKRTIKKSGYWFKEVAENNGFVD
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaatacagatttccagaaggtttttggtggggttcggcaacatcagcagtg
caaattgaaggggctgcagatgaagacggtaaagggatgaatgtatgggattattggtat
cagaaagaacctaatcgcttttttaatggaatagggtctcaagtaacatctgatttttat
catagatataaagaagatataaaacttatgaaagagttggggcacaattcatttagattt
tctatttcatggtctcgtctaattcctggtggcacaggtaaagttaacgaaaaagcagta
gaattttacaacaatgttattaatgagctcttggaaaatggtatcgaaccttttgctacc
ctttttcactttgacatgcctatagaaatgcaaaatattggaggttttgagaatagaaaa
gtagtagaatattttgctgaatatgctaagacatgttttgagttgtttggtgatagagta
aaaagatggataacatttaatgaaccgatagttcccgtattaggtgggtatttatataat
ttccattatccagatatagtggattttaaaagagcagtgcaattcggttatggcacagta
ttagcaagtgcgagggcaatagaggaatttaaaaaactaaaaataaatgatgctaaaata
ggtattgttttaaacttgagtcctgtttatccaagaagtaatcatccggcagatttaaaa
gcagcggagcttgcggatttgtttcataatagaagttttcttgacccttccgttaaaggg
gagtatcctaaagaattagtagaagttttaaaagcttacaatcatttgccggaatataag
gaagaagatttagaattaataaaagataatactgtacaatatttaggagtaaattattat
cagccgcttagagttaaagctaaagagaatatgccaaatccatatggtgtatttacaccc
aattggttttatgatgagtatattatgccaggtaggagaatgaatccttatagaggatgg
gaaatctacgaaaaagggatatatgatcttctgaaaagaataaaagatgaatatggaaac
atagagtgttttatttcagaaaatggaatgggagtggaaggggaagaacgctttataaaa
gatggtattattcaagacgactataggattgaatttataaaagagcatttaaaatgggtt
cataaagcaattgaagagggatgcaatgtcaaaggatatcatgtatggacatttatggac
aattggtcgtggcttaatgcgtataaaaaccgttatgggctcgtagcgatagatttaaaa
acgcaaaagcgtacaataaaaaagagtggttattggtttaaagaagtggcagaaaataat
ggctttgtcgattaa

DBGET integrated database retrieval system