KEGG   Thermoanaerobacter tengcongensis: TTE0359Help
Entry
TTE0359           CDS       T00081                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TTE0359
Enzymes [BR:tte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     TTE0359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
386107..387249
Genome map
AA seq 380 aa AA seqDB search
MNKWYAFTGVLVIIIIIMYLILKDTSLTFSCYEREKFPHLMGNALVKKPSVAGRLKIIEK
DGRKILGDQYGNPIQLRGMSTHGLQWFSEIINHNAFSGLSRDWESNVIRLAMYVGEGGYA
TNPSVKDKVIEGINLAIQNDMYVIVDWHVLNPGDPNADIYSGAKDFFKEIATKYPNDLHI
IYELANEPNPTPPGVTNDVEGWKKVKNYAEPIIQMLRDMGNQNIIIVGSPNWSQRPDLAA
EEPINDPNVMYSVHFYTGTHKVEEHGKPGYVFGNMAKALEKGVPIFVSEWGTSEASGDGG
PYLDEADKWLEFLNANNISWINWSLANKNEVSAAFLTSTNLNPGDGKAWAVNQLSLSGEY
VRARIKGIPYKPISREARGK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatggtatgcttttactggtgtgcttgtgataatcattataatcatgtattta
attttaaaagatacttctttaacttttagctgttatgagagagaaaaatttccgcatttg
atggggaatgctttagtaaaaaaaccttcagtagcgggtaggcttaagattatagaaaaa
gatggaagaaaaatattgggggaccagtatggcaatccaatacagctaagaggaatgagt
acacacggattgcagtggttttcagagattattaatcataatgctttttctggattgtca
agagattgggaatcaaacgtgattagacttgctatgtacgttggtgaaggtggttatgct
acaaatccaagtgttaaagataaggttatagaaggaataaatttagcaattcaaaatgat
atgtatgtaatagttgactggcatgttttaaatccgggagaccctaatgcggacatatac
agtggcgcaaaagatttcttcaaggaaatagctactaaatatccaaatgaccttcatata
atttatgaattagcaaatgagcccaatccaacccctccaggagtgacaaatgatgttgag
gggtggaaaaaagttaaaaactatgctgaaccgataattcaaatgctgagagatatgggg
aaccaaaatataattattgtaggttctcctaactggagtcaacgcccggatttagcggca
gaggaaccaataaatgatcccaatgtaatgtattctgtacatttttatacaggtactcat
aaagtagaagaacacggtaagcccggatatgtttttggcaatatggctaaagcattggaa
aaaggtgtacctatttttgtaagtgaatggggtaccagtgaagctagtggtgatggaggt
ccatatttagatgaagcagataaatggcttgaatttttaaatgccaataatataagctgg
ataaattggtctttggcaaataagaatgaagtttcagcagcatttttaacatctactaat
ttaaatcctggtgatggtaaagcatgggctgtaaatcaattgagtctctcaggagaatat
gtaagagcaagaataaaaggaattccctataaacctatttctcgtgaggcaagaggaaag
taa

DBGET integrated database retrieval system