KEGG   Thermoanaerobacter tengcongensis: TTE0377Help
Entry
TTE0377           CDS       T00081                                 

Gene name
CbiB
Definition
cobalamin biosynthesis protein CobD/CbiB
Orthology
K02227  
adenosylcobinamide-phosphate synthase [EC:6.3.1.10]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TTE0377 (CbiB)
Enzymes [BR:tte01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.10  adenosylcobinamide-phosphate synthase
     TTE0377 (CbiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
402033..402983
Genome map
AA seq 316 aa AA seqDB search
MKVFLAYILDLILGDPEGYPHPVRLIGSLISKEERIIRKYAKGERALKIAGFVMCFLTIA
TVYFTTYFALYLAGIINRYFQYLLEVVFIYTTLATKDLAKAAYRVFKPLEEKDLETARKK
LSLIVSRDTEKLEEKDIIRGVLETVSENISDGIIAPMFYAFLGGAPLAMLYKAASTLDSM
VGYKNEKYKDLGFASAKLDDILNFIPARITGVLIVVSSFLLGYDYKNSFRIFMRDRLKHE
SPNSAHGEAALAGALGVELGGINYYFGKPVIKPRLGDKKVDLSLKHIKDSVKIMYMTSFI
GLIVFYLLENFFKKLI
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtttttctggcatatattctcgatttgattttaggagaccctgagggttatcct
catcctgtaaggctgataggatctcttatatcaaaagaagaaagaataataagaaaatac
gcaaaaggtgaaagagctttaaaaattgcaggatttgtcatgtgttttttgacaattgct
acagtatattttaccacttactttgccctttatttagcgggaattataaatcgttacttc
caatacttgctcgaagtagtatttatctatacgactcttgcgacaaaagacctggcaaaa
gcggcttacagagtttttaaacctttagaagagaaagatttagaaactgctcggaaaaaa
ctttctctcatagtgagcagggatactgaaaaattagaggaaaaagacataataagagga
gttttggagacagtttcagaaaatatctcagacggaataatagctccgatgttttacgca
tttttaggaggagcccctcttgcaatgctttataaagctgcaagtaccctggattctatg
gtgggatataaaaatgaaaagtacaaagacctaggctttgcttctgctaaattagatgat
attttgaacttcatacctgcgagaataacaggggttttaatagtagtctcttccttttta
ctgggttatgactacaaaaacagtttcaggatttttatgagggataggttaaagcacgaa
agtcccaatagcgcccatggggaagctgctttggctggagcgctgggtgtagagctggga
gggataaattactattttggaaagcctgttataaagcccaggttaggagacaaaaaagtt
gatttatctttaaaacacataaaagacagcgtaaaaataatgtatatgacctcttttata
gggttaatcgtattttatctactcgaaaatttctttaaaaaattaatttga

DBGET integrated database retrieval system