KEGG   Thermoanaerobacter tengcongensis: TTE0441Help
Entry
TTE0441           CDS       T00081                                 

Gene name
FrvX
Definition
(GenBank) Cellulase M and related proteins
Organism
tte  Thermoanaerobacter tengcongensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
451831..452871
Genome map
AA seq 346 aa AA seqDB search
MDYKELLKKLSESHGVSGHERGIYQLLKKEFEEISDEVLEDNFGNLIFKKKGLKGKYKVM
LAAHLDEIGLMVKDIDEKGFIKFTPVGGVDQRTLPSQEVIVHGKKELLGVIGSKPPHLLS
SEDMEKAIKIDDMYVDVGLPKEEVEKLVSIGDIITVKREFRELLNDNVSGKALDDRAGVV
VMAVCLDELRKMYHYHDVYAVATLQEEVGVRGAITSSYNIEPDIAIAIDVTHAKARGVSR
DIEIGKGPAIGKGPNIHPAVYKGLVDIAKKYNINYQIEPLPGHSGTDAWAIQVSKKGVPT
GLVSIPLKYMHTSVETANMKDIIESGRLLAHYIANLPEELEGHLCY
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggattataaggagctgttaaaaaagcttagtgaaagtcacggggtctccggacatgaa
agaggaatttatcagcttttgaaaaaagaatttgaagagatttccgatgaagttctagag
gacaattttggaaatttaatttttaaaaagaagggtttaaaaggcaagtataaggtgatg
ctggcagcccatttggatgaaatagggcttatggtgaaagatattgatgagaaaggattt
ataaaatttacaccggttggaggagtggaccaaagaacccttccttctcaagaagtcata
gtgcacggtaaaaaagaattattgggagttatagggagtaaaccgcctcatctcttatcc
tccgaagatatggagaaggcaataaaaatagacgatatgtacgtagacgtagggcttccg
aaagaggaagtagagaagctggtaagcattggagatattataactgtgaaaagggagttt
agagaacttttgaatgataatgtttcaggaaaggctttagacgatagggcaggggttgtg
gtgatggcagtatgccttgatgaactaaggaagatgtaccattatcacgacgtgtatgct
gtagctactcttcaggaagaggtgggggtaagaggagctataacttcttcttacaatatt
gaacctgacatagctatagcgattgatgtgactcatgcgaaagcgaggggagttagccgc
gacatagagatagggaaagggcctgcgattgggaaggggcctaatattcatcctgctgta
tataaagggcttgtagatatagcgaaaaaatacaatataaattatcagatagagccgctt
cctgggcattcaggcactgatgcatgggcaatccaggtgtcaaaaaaaggagttcctaca
gggcttgtgtcaatacctttgaagtacatgcatacttctgtggaaactgctaatatgaaa
gacataatagaaagcggcagactgctggcacactatattgccaatctgcctgaggaattg
gagggacatttatgttattaa

DBGET integrated database retrieval system