KEGG   Thermoanaerobacter tengcongensis: TTE0441Help
Entry
TTE0441           CDS       T00081                                 

Gene name
FrvX
Definition
cellulase M-like protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TTE0441 (FrvX)
Enzymes [BR:tte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     TTE0441 (FrvX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
451831..452871
Genome map
AA seq 346 aa AA seqDB search
MDYKELLKKLSESHGVSGHERGIYQLLKKEFEEISDEVLEDNFGNLIFKKKGLKGKYKVM
LAAHLDEIGLMVKDIDEKGFIKFTPVGGVDQRTLPSQEVIVHGKKELLGVIGSKPPHLLS
SEDMEKAIKIDDMYVDVGLPKEEVEKLVSIGDIITVKREFRELLNDNVSGKALDDRAGVV
VMAVCLDELRKMYHYHDVYAVATLQEEVGVRGAITSSYNIEPDIAIAIDVTHAKARGVSR
DIEIGKGPAIGKGPNIHPAVYKGLVDIAKKYNINYQIEPLPGHSGTDAWAIQVSKKGVPT
GLVSIPLKYMHTSVETANMKDIIESGRLLAHYIANLPEELEGHLCY
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggattataaggagctgttaaaaaagcttagtgaaagtcacggggtctccggacatgaa
agaggaatttatcagcttttgaaaaaagaatttgaagagatttccgatgaagttctagag
gacaattttggaaatttaatttttaaaaagaagggtttaaaaggcaagtataaggtgatg
ctggcagcccatttggatgaaatagggcttatggtgaaagatattgatgagaaaggattt
ataaaatttacaccggttggaggagtggaccaaagaacccttccttctcaagaagtcata
gtgcacggtaaaaaagaattattgggagttatagggagtaaaccgcctcatctcttatcc
tccgaagatatggagaaggcaataaaaatagacgatatgtacgtagacgtagggcttccg
aaagaggaagtagagaagctggtaagcattggagatattataactgtgaaaagggagttt
agagaacttttgaatgataatgtttcaggaaaggctttagacgatagggcaggggttgtg
gtgatggcagtatgccttgatgaactaaggaagatgtaccattatcacgacgtgtatgct
gtagctactcttcaggaagaggtgggggtaagaggagctataacttcttcttacaatatt
gaacctgacatagctatagcgattgatgtgactcatgcgaaagcgaggggagttagccgc
gacatagagatagggaaagggcctgcgattgggaaggggcctaatattcatcctgctgta
tataaagggcttgtagatatagcgaaaaaatacaatataaattatcagatagagccgctt
cctgggcattcaggcactgatgcatgggcaatccaggtgtcaaaaaaaggagttcctaca
gggcttgtgtcaatacctttgaagtacatgcatacttctgtggaaactgctaatatgaaa
gacataatagaaagcggcagactgctggcacactatattgccaatctgcctgaggaattg
gagggacatttatgttattaa

DBGET integrated database retrieval system