KEGG   Thermoanaerobacter tengcongensis: TTE0442Help
Entry
TTE0442           CDS       T00081                                 

Gene name
FrvX2
Definition
(GenBank) Cellulase M and related proteins
Organism
tte  Thermoanaerobacter tengcongensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
452862..453881
Genome map
AA seq 339 aa AA seqDB search
MLLKELTELLGASGDEKEVREKIKEIVKPYVDELYVDRIGNLIACKKGKKEKPKVMLAAH
MDEVALMVKSVNEDGTLSFSPVGGVDNRILVAKAVKVGEKKINGVIGAKPIHLQKKGEQE
KPLDFDELYIDIGAASKEEALKHISPGDYVYFESNFEILGDGYVKAKALDDRIGCNVLIE
ILKNTYEYPVCAAFTVQEEVGLRGAGVAAYNVEPDFALVVEGTVAADVVDSEPHLVSTEL
GKGPAISLMDRTTLYDRKIIDKIVRIAEENNVPYQFRRIASGGNDAGKIHLTKGGIKTVA
ISVPCRYIHSFNSVAKLSDFENTVKLVDLVIKNIEEVLK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgttattaaaggagttaactgagcttttaggtgcttctggagatgaaaaagaggtaaga
gagaagataaaagagatagttaaaccttatgtggatgagctttatgtggatagaattggg
aatttgatagcctgcaaaaaagggaaaaaggaaaagccaaaggtgatgctggctgctcac
atggatgaagttgctttaatggtgaagtctgtaaatgaagacgggacattaagtttttct
cctgtgggcggagttgacaaccgtattctggtagccaaagcagtaaaggtaggggagaag
aagataaacggggtaataggtgcaaaacctatacatcttcagaaaaaaggagagcaggaa
aaacctcttgactttgatgaactctatatagacattggagcagcatctaaagaagaagct
ttaaagcacatttcacccggtgactatgtctactttgaatcaaatttcgagattttaggg
gatggctatgtcaaggcaaaggctttggacgatagaataggctgtaatgtattaatagaa
attttgaaaaatacatatgaatatcctgtttgcgcggcttttacagtgcaagaagaggtt
ggtttaagaggagcgggtgttgcggcttataatgtagagcctgattttgcgttagttgtg
gaaggaactgtagctgcggatgttgtggattcagagcctcatctggtttccacagagctg
ggaaaagggcctgcaatttcacttatggatagaactactttgtatgacagaaagattatt
gacaagattgtcaggatagcagaagagaataatgtaccttatcagtttaggagaatagcg
agcggtggaaatgatgcaggtaaaatacaccttacaaaaggaggaataaagacagtagct
atttctgtgccttgtagatacatccattctttcaactctgtagctaagctgagtgacttt
gaaaatacagttaagcttgtggacttagtgattaaaaatattgaggaggtattgaaatga

DBGET integrated database retrieval system