KEGG   Thermoanaerobacter tengcongensis: TTE0443Help
Entry
TTE0443           CDS       T00081                                 

Gene name
FrvX3
Definition
(GenBank) Cellulase M and related proteins
Organism
tte  Thermoanaerobacter tengcongensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
453878..454861
Genome map
AA seq 327 aa AA seqDB search
MSVNVELIKKLTQAFGPSGSEEKVFEIIREEVKGFCDEITHDAMGNMICVKKGKGKKIMV
AAHADEIGIMVTHIEEEGFLRFTTIGGVYVEHLVGRRVKFKNGTVGVIGVEHLEDKKDFK
LEKLYIDIGAKDKKEAEELVKIGESGSFVGEFVEAGDRLISKAFDDRIGCYVAIEALKNV
KTENELYFVFTVQEEVGLRGATTAAYSINPDFAIAVDVTATGDTPKAKKMAVALGKGAAI
KVMDRSIIVSPSVRDMMIEVAKENSIPYQLEILEFGGTDAGAIHLSRGGVPSGVISIPTR
YVHSVSEMVDKKDVEASINLLIKILEK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgaatgtggaacttataaaaaagctaacacaggcttttggaccttcgggaagt
gaggagaaggtttttgagattataagagaggaagtcaaaggtttttgcgatgaaattact
catgatgcgatgggaaacatgatatgtgtgaaaaagggaaaagggaaaaagataatggtg
gctgctcatgctgatgaaataggcattatggttacgcatattgaagaggaaggcttcttg
aggttcacaacgataggtggcgtttatgtagagcaccttgtaggaagaagagttaagttt
aaaaatggtacagtaggagtaattggagtagagcatttggaggataaaaaggattttaaa
ctggagaagctttacatagatataggtgcaaaagataaaaaagaggcagaagagcttgtc
aaaataggggagagtggaagcttcgtaggagagtttgtagaagctggagataggttaatt
tccaaggcttttgacgacaggataggatgctatgtggcgattgaagcgctaaaaaacgtg
aagacagaaaatgagctgtattttgttttcacagtgcaagaagaggtaggcttaagaggt
gctactacagccgcttacagtattaatcctgattttgctattgctgtggatgtaactgca
acgggagatactcctaaagcgaagaaaatggcggtagctctcggtaaaggtgcagcaata
aaggtaatggacagatcgataattgtgagcccttctgtgagagatatgatgattgaagtg
gcgaaagagaacagtattccgtatcaattagaaatactggaatttggcggtactgatgca
ggagcgattcacctttcaagagggggagtaccctctggagtgatttctattcccacaagg
tatgttcacagcgtttcagagatggtggataagaaggacgtagaggcaagtattaacctc
ctgataaaaatactggaaaaataa

DBGET integrated database retrieval system