KEGG   Thermoanaerobacter tengcongensis: TTE0489Help
Entry
TTE0489           CDS       T00081                                 

Gene name
RecD
Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tte03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
501695..503992
Genome map
AA seq 765 aa AA seqDB search
MTKIKGLNPLYPPLNRLKLSCKISLTGGKAMVEIEGVVEEIIFRNEQNGYTVLELDIEGD
MVTAVGVMPFVTVGERIKVQGEWVVHPDYGDQIRVINYQTLSPNTLEGIERFLASGLIPG
IGPVTARKIVERFGLDSLHVIETEPHRLREIKGLSDEKIKRISEAYEMQKGIKEVMVFLH
QFGISSHMAIKIYKEYGNNAIEIIKQNPYRLADDIFGIGFKTADKIAESLGIDPHSTYRI
SAGARYVLMQYAANGHTYVPKELLKKETAQLLEVSEEEVEDAFVLLAQNEKIHIERFEDE
TVGVYYIPYYVAELHTAERLFTMTVTQCEDLKIDVQKEIRDFEKEAGIVLEKTQKLAVEE
AIKNSVVVITGGPGTGKTTIINCIIRIFEKANKKVALAAPTGRAAKRITEATGKEAKTIH
RLLEYTYTEEEGKGFNKNEKDPLKYDVIIIDEASMVDILLMNALLKAIPAGSRLILVGDA
DQLPSVGAGNVLRDIIDSGIVKVIRLKEIFRQQKESLIVVNAHKINNGEYPTYNDKNGDF
FFLSVATQEDMLKTILDLVTNRLPKAYGFHPVNDIQVLTPMKKGIIGVHNLNIELQKVLN
PPSKDKAEKPMKEFTFRVGDKVMQIKNNYRMTWKRGHEEGEGVFNGDIGIIQSIDEELQE
VTVYFDDEKVVTYDFSDLDELTLSYAITVHKSQGSEFPVVIMPVTYGPPMLLTRNLLYTA
VTRAKKLVVLVGQEKYLKFMIDNNRISKRYSGLLSRLKKTLIYIQ
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
ttgacaaaaataaaaggcctaaaccctttatatcctcctctaaataggttaaaattaagt
tgtaaaatatctttaacgggtggaaaagccatggtagaaatagagggtgtagtagaagag
ataatctttagaaacgagcaaaacgggtatacggttctggaattggatattgaaggggat
atggtgactgctgtaggtgtaatgccctttgttacggtgggagagagaataaaggtgcag
ggggaatgggtagtccatcctgattacggagaccagatacgagttatcaattaccagact
ctttctcccaataccctggaagggatagagcgctttttagcatcaggcctgatacctggg
attggccctgtcaccgcgagaaagattgtagaaagatttgggcttgactctcttcatgtt
atagagacagagcctcacaggttgagggagataaaaggtttaagcgatgagaagataaag
agaataagtgaagcttatgagatgcagaagggaataaaagaagtaatggtgtttctacat
caattcgggatttctagccatatggctataaaaatatacaaagaatacgggaataatgca
atagaaatcatcaagcaaaatccttacagacttgctgatgacatattcggcataggattt
aagactgctgacaaaattgcggagagcttgggcattgacccgcattccacataccgcatt
tctgcaggggcaaggtatgttttaatgcagtacgctgcaaatgggcacacctatgtgcca
aaagaactcttaaaaaaagaaactgcccagctcctcgaggtaagcgaagaagaagtggag
gatgcttttgtgcttttagctcaaaatgaaaaaatacacatagaaaggtttgaggacgaa
acagtaggggtttattacatcccctattatgtggcagaacttcatactgcagaaaggctt
tttacaatgacagtgacccagtgcgaagacctcaaaatagacgtgcaaaaagaaataagg
gattttgaaaaagaagcaggaatagttttagagaaaactcaaaaattggcggtagaagaa
gccataaagaattcggtcgtggtcataacaggaggacctggcacgggtaagactacgatt
ataaactgtataataaggatttttgaaaaagccaataaaaaagtggcccttgctgctcct
acaggaagagcggcaaagaggataactgaagcaacgggaaaagaggcaaagaccattcac
aggcttttagagtatacctatacggaagaggaagggaaagggtttaataaaaacgaaaaa
gatcctttaaaatacgatgtaatcataatagatgaagcttctatggtggatattttgctt
atgaatgctcttttaaaggctattcctgccggatcaaggcttattcttgtgggagatgct
gaccagctcccatctgttggagcgggaaatgttttaagagacataatagacagtggaatt
gtaaaagtgatacggctaaaagaaatattcaggcagcagaaagagagccttattgtagta
aatgcccacaagataaataacggcgaatatcctacctacaatgacaaaaatggagacttc
ttctttttaagcgtagctacacaggaagacatgctaaagacaatactagaccttgtgact
aataggcttcctaaagcttatggctttcatccggttaacgatattcaggtccttactccc
atgaaaaagggaataataggagtgcacaatttaaatatagaacttcagaaggtcttaaac
cctccttctaaagacaaagcagaaaaaccaatgaaagaatttacttttagagtcggtgat
aaagtgatgcagatcaagaacaactatagaatgacctggaaaagagggcatgaggaagga
gaaggagttttcaacggtgacatagggataatccagtcaatagatgaggaacttcaagaa
gttaccgtgtattttgacgacgaaaaagtagtgacttacgatttttccgatttggacgaa
cttaccttatcttacgctatcacagttcacaagagtcagggcagcgaatttcctgtggtg
ataatgccagtgacatacggacctcctatgcttttaacccgcaatcttctttacacagct
gttacaagggcaaaaaagctggtggttttagtagggcaggagaaatatttaaaatttatg
attgacaacaacaggatttctaaaagatattcaggacttctttccaggctaaaaaagacc
ttgatttacatccaataa

DBGET integrated database retrieval system