KEGG   Caldanaerobacter subterraneus subsp. tengcongensis: TTE0690Help
Entry
TTE0690           CDS       T00081                                 

Gene name
AceF2
Definition
(GenBank) Dihydrolipoamide acyltransferases
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tte  Caldanaerobacter subterraneus subsp. tengcongensis
Pathway
tte00010  Glycolysis / Gluconeogenesis
tte00020  Citrate cycle (TCA cycle)
tte00620  Pyruvate metabolism
tte01100  Metabolic pathways
tte01110  Biosynthesis of secondary metabolites
tte01120  Microbial metabolism in diverse environments
tte01130  Biosynthesis of antibiotics
tte01200  Carbon metabolism
Module
tte_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTE0690 (AceF2)
   00020 Citrate cycle (TCA cycle)
    TTE0690 (AceF2)
   00620 Pyruvate metabolism
    TTE0690 (AceF2)
Enzymes [BR:tte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TTE0690 (AceF2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AAM23952
UniProt: Q8RBW8
Position
694595..695794
Genome map
AA seq 399 aa AA seqDB search
MPYEFRMPNVVSNGIEGFVVNWFKDEGQPVQAGELLLEVQFEKAAIELQAPVSGILTKIL
CPQGHVVKVGQLLCLIEEKSTEVAGGSGSAVPPVHAPEETPHFHGETERTTQSTPVDSQV
HSSNTGDVRATPAARKLARELGIPLEAVPGTGPGGRITEEDVKNFAQRSEKTNLTARRVP
LTPTQRLVGSRMLQSLRETAQYTLGREVDISALIKVRMELKQKGSPANITDLIHKAVVQA
ILENPVMQAVIDGDDMVVPAEVHLGFAVARGDELLVPVIKNAHRLNLNEMAVERRRLTDA
VLQGIIKPEELQGGTFTVTNLGTYGVDFFTPVLYPKQSAILGIGRIVERPVLENGNIRSA
QFMTLSLTVDHQVINGAPAARFLNRLAELLSQPEVLLEL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgccatacgaatttcgcatgcctaacgtagtatcaaatggaatagaagggtttgtggtg
aattggttcaaggatgaaggacagccagtacaagcaggtgaattgctgttggaagtacaa
tttgaaaaagcggctattgaactccaggctccagtaagcggcatactgacaaaaatccta
tgtccccaaggtcatgtagtcaaggttggacaactgctctgtttgatcgaagaaaaatcc
acagaagtggctggaggtagtggatctgcggtacctccggtccatgcaccagaggaaaca
ccccacttccacggcgaaacggagcgaacaacccagagtactccagtggattcccaagtc
catagtagcaacacgggcgatgtaagagccactcctgcagcccgtaagctcgcccgcgaa
ttgggaattcctctagaggcagtgccgggtactggtccgggcggtcgaattactgaggaa
gatgttaagaattttgctcagcgttctgaaaagacaaatttaacagcaagaagagtacca
ctcactcctacccagcgtttagtcgggtcaaggatgttacagagtcttcgagaaactgca
cagtatacattagggcgggaagtagatataagcgcgttaatcaaagtccgcatggagctt
aaacaaaaaggttcacctgctaacataacggatcttatacataaagcagtggttcaggcg
attttagaaaatcctgtaatgcaggccgttattgatggagatgatatggtagtgcctgca
gaagttcacttgggatttgctgttgcccgtggcgatgaacttctagtgcctgtaatcaaa
aatgctcatagactcaatcttaatgaaatggctgttgaaagacgccgacttactgatgca
gttctacaaggtattataaagccagaagagctacaagggggtacctttacagttacaaat
ctgggtacttatggtgttgatttctttacccctgtgctatatccaaaacaatctgcaatt
ctcggtattggaagaatagtggaacgaccagtccttgagaatggaaacatccgctccgcg
caatttatgactcttagtcttactgtagatcatcaggtaataaacggtgcccctgctgct
agattcttaaatcgactggcagaacttctttctcaaccggaagtgctcttggagttgtaa

DBGET integrated database retrieval system