KEGG   Thermoanaerobacter tengcongensis: TTE0696Help
Entry
TTE0696           CDS       T00081                                 

Gene name
EutG
Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:tte01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tte00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:tte00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:tte00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:tte00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:tte00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
701652..702680
Genome map
AA seq 342 aa AA seqDB search
MIEPALNTFGFKYSLYDKVGPNPTVDMIDEAAKFGRETGAKAVIGIGGGSPIDTAKSVAV
LLEYTDKNARELYELKFTPEKAAPIIAINLTHGTGTEVDRFAVATIPEKNYKPAIAYECL
YPMYAIDDPALMIKLDKKQTIAVTIDALNHVTEAATTLVTSPYSILLAKEAVRLIVRYLP
VAVNDPENLVARYYLLYASAIAGISFDNGLLHLTHALEHPLSAVKPEIAHGLGLGALLPA
VVKTIYPAVAEVLADIYSPIVPGLKGLPAEAEYVAKKVEEWLFNVGCTQKLSDFGFTKDD
VPTLVKLAKTTPSLNGLLSIAPVEATETVIAKIYEESLNPIS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgatagaaccggctctaaatacattcggtttcaaatattcactttatgacaaggtcgga
cctaatcctactgttgatatgatcgatgaagcggccaaattcggccgggaaactggggcg
aaggctgttattggcattggtggaggaagccctatagatactgcaaaaagtgtggctgta
ctgttagaatatactgataaaaatgcaagagaactttatgaactgaaattcacgcccgaa
aaagctgctcctattatagctataaatcttactcatggtactggtacggaggtagaccga
tttgcagtagctacaattccagaaaaaaattataagcccgcgatagcttatgagtgcctc
tatcctatgtatgccatagatgatcctgctctcatgataaagcttgataaaaaacagaca
atagctgttactatagatgctttaaatcacgttaccgaagctgccactactcttgtgaca
tcaccttacagtattctattggcgaaagaggcagtgaggttgatagttcgttacctccct
gttgctgtaaatgaccctgaaaaccttgtggctagatattatttgctttatgcttctgct
atagctggtatttcttttgacaatggtctcttgcaccttactcatgccctggagcaccca
ctaagtgcagtaaaacctgagattgcccacggtcttgggcttggtgctctactgcctgca
gtggtaaaaactatttatcctgctgttgcagaggtgttagctgacatatacagccctatc
gtgcctggactaaaaggactgcctgctgaagcagaatatgtagctaaaaaagtcgaagaa
tggctcttcaatgtaggatgtactcaaaaactttcagactttggatttacaaaagatgat
gttccaaccctggtaaagcttgctaaaacgacaccttctctcaatggattgctttctatt
gcaccagtggaagctactgaaactgttattgccaagatttatgaagagtctcttaaccca
atctcttaa

DBGET integrated database retrieval system