KEGG   Thermoanaerobacter tengcongensis: TTE0696Help
Entry
TTE0696           CDS       T00081                                 

Gene name
EutG
Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    TTE0696 (EutG)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTE0696 (EutG)
  Lipid metabolism
   00071 Fatty acid degradation
    TTE0696 (EutG)
  Amino acid metabolism
   00350 Tyrosine metabolism
    TTE0696 (EutG)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TTE0696 (EutG)
   00626 Naphthalene degradation
    TTE0696 (EutG)
Enzymes [BR:tte01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     TTE0696 (EutG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
701652..702680
Genome map
AA seq 342 aa AA seqDB search
MIEPALNTFGFKYSLYDKVGPNPTVDMIDEAAKFGRETGAKAVIGIGGGSPIDTAKSVAV
LLEYTDKNARELYELKFTPEKAAPIIAINLTHGTGTEVDRFAVATIPEKNYKPAIAYECL
YPMYAIDDPALMIKLDKKQTIAVTIDALNHVTEAATTLVTSPYSILLAKEAVRLIVRYLP
VAVNDPENLVARYYLLYASAIAGISFDNGLLHLTHALEHPLSAVKPEIAHGLGLGALLPA
VVKTIYPAVAEVLADIYSPIVPGLKGLPAEAEYVAKKVEEWLFNVGCTQKLSDFGFTKDD
VPTLVKLAKTTPSLNGLLSIAPVEATETVIAKIYEESLNPIS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgatagaaccggctctaaatacattcggtttcaaatattcactttatgacaaggtcgga
cctaatcctactgttgatatgatcgatgaagcggccaaattcggccgggaaactggggcg
aaggctgttattggcattggtggaggaagccctatagatactgcaaaaagtgtggctgta
ctgttagaatatactgataaaaatgcaagagaactttatgaactgaaattcacgcccgaa
aaagctgctcctattatagctataaatcttactcatggtactggtacggaggtagaccga
tttgcagtagctacaattccagaaaaaaattataagcccgcgatagcttatgagtgcctc
tatcctatgtatgccatagatgatcctgctctcatgataaagcttgataaaaaacagaca
atagctgttactatagatgctttaaatcacgttaccgaagctgccactactcttgtgaca
tcaccttacagtattctattggcgaaagaggcagtgaggttgatagttcgttacctccct
gttgctgtaaatgaccctgaaaaccttgtggctagatattatttgctttatgcttctgct
atagctggtatttcttttgacaatggtctcttgcaccttactcatgccctggagcaccca
ctaagtgcagtaaaacctgagattgcccacggtcttgggcttggtgctctactgcctgca
gtggtaaaaactatttatcctgctgttgcagaggtgttagctgacatatacagccctatc
gtgcctggactaaaaggactgcctgctgaagcagaatatgtagctaaaaaagtcgaagaa
tggctcttcaatgtaggatgtactcaaaaactttcagactttggatttacaaaagatgat
gttccaaccctggtaaagcttgctaaaacgacaccttctctcaatggattgctttctatt
gcaccagtggaagctactgaaactgttattgccaagatttatgaagagtctcttaaccca
atctcttaa

DBGET integrated database retrieval system