KEGG   Thermoanaerobacter tengcongensis: TTE0696Help
Entry
TTE0696           CDS       T00081                                 

Gene name
EutG
Definition
(GenBank) Alcohol dehydrogenase IV
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
tte00010  Glycolysis / Gluconeogenesis
tte00071  Fatty acid degradation
tte00350  Tyrosine metabolism
tte00625  Chloroalkane and chloroalkene degradation
tte00626  Naphthalene degradation
tte01100  Metabolic pathways
tte01110  Biosynthesis of secondary metabolites
tte01120  Microbial metabolism in diverse environments
tte01130  Biosynthesis of antibiotics
tte01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTE0696 (EutG)
  Lipid metabolism
   00071 Fatty acid degradation
    TTE0696 (EutG)
  Amino acid metabolism
   00350 Tyrosine metabolism
    TTE0696 (EutG)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TTE0696 (EutG)
   00626 Naphthalene degradation
    TTE0696 (EutG)
Enzymes [BR:tte01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     TTE0696 (EutG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AAM23958
UniProt: Q8RBW2
Position
701652..702680
Genome map
AA seq 342 aa AA seqDB search
MIEPALNTFGFKYSLYDKVGPNPTVDMIDEAAKFGRETGAKAVIGIGGGSPIDTAKSVAV
LLEYTDKNARELYELKFTPEKAAPIIAINLTHGTGTEVDRFAVATIPEKNYKPAIAYECL
YPMYAIDDPALMIKLDKKQTIAVTIDALNHVTEAATTLVTSPYSILLAKEAVRLIVRYLP
VAVNDPENLVARYYLLYASAIAGISFDNGLLHLTHALEHPLSAVKPEIAHGLGLGALLPA
VVKTIYPAVAEVLADIYSPIVPGLKGLPAEAEYVAKKVEEWLFNVGCTQKLSDFGFTKDD
VPTLVKLAKTTPSLNGLLSIAPVEATETVIAKIYEESLNPIS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgatagaaccggctctaaatacattcggtttcaaatattcactttatgacaaggtcgga
cctaatcctactgttgatatgatcgatgaagcggccaaattcggccgggaaactggggcg
aaggctgttattggcattggtggaggaagccctatagatactgcaaaaagtgtggctgta
ctgttagaatatactgataaaaatgcaagagaactttatgaactgaaattcacgcccgaa
aaagctgctcctattatagctataaatcttactcatggtactggtacggaggtagaccga
tttgcagtagctacaattccagaaaaaaattataagcccgcgatagcttatgagtgcctc
tatcctatgtatgccatagatgatcctgctctcatgataaagcttgataaaaaacagaca
atagctgttactatagatgctttaaatcacgttaccgaagctgccactactcttgtgaca
tcaccttacagtattctattggcgaaagaggcagtgaggttgatagttcgttacctccct
gttgctgtaaatgaccctgaaaaccttgtggctagatattatttgctttatgcttctgct
atagctggtatttcttttgacaatggtctcttgcaccttactcatgccctggagcaccca
ctaagtgcagtaaaacctgagattgcccacggtcttgggcttggtgctctactgcctgca
gtggtaaaaactatttatcctgctgttgcagaggtgttagctgacatatacagccctatc
gtgcctggactaaaaggactgcctgctgaagcagaatatgtagctaaaaaagtcgaagaa
tggctcttcaatgtaggatgtactcaaaaactttcagactttggatttacaaaagatgat
gttccaaccctggtaaagcttgctaaaacgacaccttctctcaatggattgctttctatt
gcaccagtggaagctactgaaactgttattgccaagatttatgaagagtctcttaaccca
atctcttaa

DBGET integrated database retrieval system