KEGG   Thermoanaerobacter tengcongensis: TTE0731Help
Entry
TTE0731           CDS       T00081                                 

Gene name
CpsG
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTE0731 (CpsG)
   00030 Pentose phosphate pathway
    TTE0731 (CpsG)
   00051 Fructose and mannose metabolism
    TTE0731 (CpsG)
   00052 Galactose metabolism
    TTE0731 (CpsG)
   00500 Starch and sucrose metabolism
    TTE0731 (CpsG)
   00520 Amino sugar and nucleotide sugar metabolism
    TTE0731 (CpsG)
  Nucleotide metabolism
   00230 Purine metabolism
    TTE0731 (CpsG)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TTE0731 (CpsG)
Enzymes [BR:tte01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     TTE0731 (CpsG)
    5.4.2.8  phosphomannomutase
     TTE0731 (CpsG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
734231..735598
Genome map
AA seq 455 aa AA seqDB search
MRLNENMFRMYDIRGIWGEDLTEETAEVIGKAFGTYVKQKGINSVLVGRDNRISSKPIRD
ALIKGLTSTGCDVLDVGVLTTPAFYYSNILYNSQAGMMITASHNPPQFNGFKVMVGPSTI
YGEELKKIYYIAEKGEFEKGSGEVKYAYPINSYINMIKEKVKLGDRKLKVVVDCGNGTAS
LFYPDVIYNLGCEVYPLYCESDPTFPNHFPDPVKEENLKDLIEEVKRVKADLGIAFDGDG
DRIGVVDEKGNIIWGDMLMILYWREIMKKHPGAEAIVEVKCSQALVEEIEKLGGKPVFYK
TGHSLIKAKMKEMNAVFTGEMSGHMFFADEYYGFDDAAYAAARLLRILSNTDKSLSELLA
DVPKYPSTPEIRLECSDERKFDVVKGVTEYFREKGYNIIDVDGARVLFDGGWGLVRASNT
GPELIVRCEARTSEKLEEIKKELSEALAKFGVKFE
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgagattaaatgagaacatgtttagaatgtacgacataagaggcatatggggagaagac
ctgactgaagagactgcagaggtcataggtaaagcttttggaacttatgtaaaacaaaag
ggaattaatagtgtgctggttggtagagacaacaggatttcttcaaagcccataagagat
gctctaataaaaggacttacttctactggttgtgacgttttggatgtaggggttttaacg
actccagccttttattattccaatattttatacaattcccaggcaggtatgatgataaca
gcaagccacaacccgccgcagtttaacggctttaaagttatggtgggaccttctaccatc
tatggtgaagagcttaagaaaatttattacatagcagaaaagggggaatttgaaaaaggc
tctggagaggtaaaatacgcttatccgataaattcttacatcaatatgataaaggaaaaa
gttaaactgggagatagaaaattaaaagttgttgtggactgtgggaatggcactgcttcg
cttttctatccagatgtcatatacaatttgggctgtgaggtatatcccctctactgcgaa
tcagacccaacttttcccaatcatttccctgaccctgtaaaagaagagaatttgaaggat
ttgatagaggaagtaaagagagtaaaggcagatttggggatagcttttgatggagatgga
gacaggattggagtggtggatgaaaagggcaatataatctggggagacatgttgatgatt
ctctactggagagaaataatgaagaaacacccaggcgctgaagcaattgtggaagtgaag
tgttctcaggctttggttgaagaaattgagaaactgggtggaaaacctgtattttacaaa
acaggtcattccctcataaaagctaagatgaaagaaatgaatgcggtcttcacaggagag
atgtcaggacacatgttctttgcagatgagtactatgggtttgacgatgcagcatatgcg
gctgcaaggcttttgagaatactttctaatacggataaaagtctatctgagcttttagct
gatgttccaaaatatccatcaactcctgagataaggcttgagtgcagtgatgagaggaaa
tttgatgtagtaaaaggggtgacggagtactttagagaaaaaggttataacataattgat
gttgatggagcgagagtgctctttgatggaggatggggattggtcagagcttctaatact
gggccagagcttattgtgagatgtgaagctagaacttcagaaaagcttgaggaaattaaa
aaagaactttcagaggctttagccaagtttggcgtgaagtttgaataa

DBGET integrated database retrieval system