KEGG   Caldanaerobacter subterraneus subsp. tengcongensis: TTE0731Help
Entry
TTE0731           CDS       T00081                                 

Gene name
CpsG
Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
tte  Caldanaerobacter subterraneus subsp. tengcongensis
Pathway
tte00010  Glycolysis / Gluconeogenesis
tte00030  Pentose phosphate pathway
tte00051  Fructose and mannose metabolism
tte00052  Galactose metabolism
tte00230  Purine metabolism
tte00500  Starch and sucrose metabolism
tte00520  Amino sugar and nucleotide sugar metabolism
tte00521  Streptomycin biosynthesis
tte01100  Metabolic pathways
tte01110  Biosynthesis of secondary metabolites
tte01120  Microbial metabolism in diverse environments
tte01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTE0731 (CpsG)
   00030 Pentose phosphate pathway
    TTE0731 (CpsG)
   00051 Fructose and mannose metabolism
    TTE0731 (CpsG)
   00052 Galactose metabolism
    TTE0731 (CpsG)
   00500 Starch and sucrose metabolism
    TTE0731 (CpsG)
   00520 Amino sugar and nucleotide sugar metabolism
    TTE0731 (CpsG)
  Nucleotide metabolism
   00230 Purine metabolism
    TTE0731 (CpsG)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TTE0731 (CpsG)
Enzymes [BR:tte01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     TTE0731 (CpsG)
    5.4.2.8  phosphomannomutase
     TTE0731 (CpsG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218 CCB1
Motif
Other DBs
NCBI-ProteinID: AAM23993
UniProt: Q8RBS8
Position
734231..735598
Genome map
AA seq 455 aa AA seqDB search
MRLNENMFRMYDIRGIWGEDLTEETAEVIGKAFGTYVKQKGINSVLVGRDNRISSKPIRD
ALIKGLTSTGCDVLDVGVLTTPAFYYSNILYNSQAGMMITASHNPPQFNGFKVMVGPSTI
YGEELKKIYYIAEKGEFEKGSGEVKYAYPINSYINMIKEKVKLGDRKLKVVVDCGNGTAS
LFYPDVIYNLGCEVYPLYCESDPTFPNHFPDPVKEENLKDLIEEVKRVKADLGIAFDGDG
DRIGVVDEKGNIIWGDMLMILYWREIMKKHPGAEAIVEVKCSQALVEEIEKLGGKPVFYK
TGHSLIKAKMKEMNAVFTGEMSGHMFFADEYYGFDDAAYAAARLLRILSNTDKSLSELLA
DVPKYPSTPEIRLECSDERKFDVVKGVTEYFREKGYNIIDVDGARVLFDGGWGLVRASNT
GPELIVRCEARTSEKLEEIKKELSEALAKFGVKFE
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgagattaaatgagaacatgtttagaatgtacgacataagaggcatatggggagaagac
ctgactgaagagactgcagaggtcataggtaaagcttttggaacttatgtaaaacaaaag
ggaattaatagtgtgctggttggtagagacaacaggatttcttcaaagcccataagagat
gctctaataaaaggacttacttctactggttgtgacgttttggatgtaggggttttaacg
actccagccttttattattccaatattttatacaattcccaggcaggtatgatgataaca
gcaagccacaacccgccgcagtttaacggctttaaagttatggtgggaccttctaccatc
tatggtgaagagcttaagaaaatttattacatagcagaaaagggggaatttgaaaaaggc
tctggagaggtaaaatacgcttatccgataaattcttacatcaatatgataaaggaaaaa
gttaaactgggagatagaaaattaaaagttgttgtggactgtgggaatggcactgcttcg
cttttctatccagatgtcatatacaatttgggctgtgaggtatatcccctctactgcgaa
tcagacccaacttttcccaatcatttccctgaccctgtaaaagaagagaatttgaaggat
ttgatagaggaagtaaagagagtaaaggcagatttggggatagcttttgatggagatgga
gacaggattggagtggtggatgaaaagggcaatataatctggggagacatgttgatgatt
ctctactggagagaaataatgaagaaacacccaggcgctgaagcaattgtggaagtgaag
tgttctcaggctttggttgaagaaattgagaaactgggtggaaaacctgtattttacaaa
acaggtcattccctcataaaagctaagatgaaagaaatgaatgcggtcttcacaggagag
atgtcaggacacatgttctttgcagatgagtactatgggtttgacgatgcagcatatgcg
gctgcaaggcttttgagaatactttctaatacggataaaagtctatctgagcttttagct
gatgttccaaaatatccatcaactcctgagataaggcttgagtgcagtgatgagaggaaa
tttgatgtagtaaaaggggtgacggagtactttagagaaaaaggttataacataattgat
gttgatggagcgagagtgctctttgatggaggatggggattggtcagagcttctaatact
gggccagagcttattgtgagatgtgaagctagaacttcagaaaagcttgaggaaattaaa
aaagaactttcagaggctttagccaagtttggcgtgaagtttgaataa

DBGET integrated database retrieval system