KEGG   Thermoanaerobacter tengcongensis: TTE0732Help
Entry
TTE0732           CDS       T00081                                 

Gene name
GalU
Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
tte00040  Pentose and glucuronate interconversions
tte00052  Galactose metabolism
tte00500  Starch and sucrose metabolism
tte00520  Amino sugar and nucleotide sugar metabolism
tte01100  Metabolic pathways
tte01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TTE0732 (GalU)
   00052 Galactose metabolism
    TTE0732 (GalU)
   00500 Starch and sucrose metabolism
    TTE0732 (GalU)
   00520 Amino sugar and nucleotide sugar metabolism
    TTE0732 (GalU)
Enzymes [BR:tte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     TTE0732 (GalU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AAM23994
UniProt: Q8RBS7
Position
735617..736525
Genome map
AA seq 302 aa AA seqDB search
MKIKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVQSGIEDILIITGRNK
RAIEDHFDKSVELELELKKKNQESLLSLVEDISNMVNIHYIRQKEPKGLGHAIYCAKSFV
GNEPFAVLLGDDVVDAEVPVLKQMIEQFERYNCTIIGVQEVPEEDVHKYGIVSGTFIEDR
LYKVNDLIEKPRREEAPSNIAILGRYIITPRIFEILEHTPPGRGGEIQLTDALKTLLNYE
AIYAYNFIGKRYDVGDKLGYLMATVEYALKREDLREPFKRYLITIVQDLLGMEEAAVTER
DV
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaagaaagcgataattccagcagcgggccttggtaccaggtttttacctgct
accaaggctcagcctaaggaaatgcttccaattgtagacaagcctactatacagtacata
gtggaagaagcggtacagtcaggaatagaggatattcttataataactggaaggaacaaa
agagccatagaagatcattttgacaaatctgtagaattggagctagaattaaagaaaaag
aatcaggaaagtttactaagccttgtagaagatattagcaatatggtaaatattcactat
ataagacaaaaagaacctaaaggcttggggcatgccatttactgtgctaaatcttttgtt
ggcaatgagcctttcgcagtgcttttaggagatgacgtggtggatgctgaagtacctgtt
ttaaagcagatgatagagcagtttgagaggtataattgcaccataattggagtgcaggaa
gtgcctgaagaggatgtacataaatatggaattgtaagcggtacttttattgaggatagg
ctatataaagtcaatgatttgatagaaaagccaaggagagaggaagcaccttctaatata
gctattttgggaaggtatataattacaccgcgaatatttgagattttggaacatacgcct
cctggaagaggaggagaaatacaattgacagacgctttaaaaactcttttaaattatgag
gccatttacgcctataattttataggcaaaaggtatgatgtgggggataaactgggctat
ctcatggcgactgtggaatatgctttgaaaagggaagatttgagagagccttttaaaagg
tatttgataacaattgtccaggatttacttggtatggaagaagccgcagtgactgaaaga
gatgtgtaa

DBGET integrated database retrieval system