KEGG   Thermoanaerobacter tengcongensis: TTE0732Help
Entry
TTE0732           CDS       T00081                                 

Gene name
GalU
Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:tte00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tte00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tte00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tte00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
735617..736525
Genome map
AA seq 302 aa AA seqDB search
MKIKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVQSGIEDILIITGRNK
RAIEDHFDKSVELELELKKKNQESLLSLVEDISNMVNIHYIRQKEPKGLGHAIYCAKSFV
GNEPFAVLLGDDVVDAEVPVLKQMIEQFERYNCTIIGVQEVPEEDVHKYGIVSGTFIEDR
LYKVNDLIEKPRREEAPSNIAILGRYIITPRIFEILEHTPPGRGGEIQLTDALKTLLNYE
AIYAYNFIGKRYDVGDKLGYLMATVEYALKREDLREPFKRYLITIVQDLLGMEEAAVTER
DV
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaagaaagcgataattccagcagcgggccttggtaccaggtttttacctgct
accaaggctcagcctaaggaaatgcttccaattgtagacaagcctactatacagtacata
gtggaagaagcggtacagtcaggaatagaggatattcttataataactggaaggaacaaa
agagccatagaagatcattttgacaaatctgtagaattggagctagaattaaagaaaaag
aatcaggaaagtttactaagccttgtagaagatattagcaatatggtaaatattcactat
ataagacaaaaagaacctaaaggcttggggcatgccatttactgtgctaaatcttttgtt
ggcaatgagcctttcgcagtgcttttaggagatgacgtggtggatgctgaagtacctgtt
ttaaagcagatgatagagcagtttgagaggtataattgcaccataattggagtgcaggaa
gtgcctgaagaggatgtacataaatatggaattgtaagcggtacttttattgaggatagg
ctatataaagtcaatgatttgatagaaaagccaaggagagaggaagcaccttctaatata
gctattttgggaaggtatataattacaccgcgaatatttgagattttggaacatacgcct
cctggaagaggaggagaaatacaattgacagacgctttaaaaactcttttaaattatgag
gccatttacgcctataattttataggcaaaaggtatgatgtgggggataaactgggctat
ctcatggcgactgtggaatatgctttgaaaagggaagatttgagagagccttttaaaagg
tatttgataacaattgtccaggatttacttggtatggaagaagccgcagtgactgaaaga
gatgtgtaa

DBGET integrated database retrieval system