KEGG   Thermoanaerobacter tengcongensis: TTE0783Help
Entry
TTE0783           CDS       T00081                                 

Gene name
FolC
Definition
folylpolyglutamate synthase
Orthology
K11754  
dihydrofolate synthase / folylpolyglutamate synthase [EC:6.3.2.12 6.3.2.17]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tte00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
782921..784216
Genome map
AA seq 431 aa AA seqDB search
MGQMTYEEAIQYIHSTYKFGMKLGLENIKRLLGYMGNPEKNLKIIHVAGTNGKGSTSSFI
SSILKEAGYKVALYTSPYLEEFEERMKINGENISREKLVYYVEYIKPIIARMVQEGYNHP
TEFEVITAIAFKYFSDEEVDFVVLEVGLGGRFDATNAISSSLVSVITSIDYDHMDKLGNT
LGDIAYEKAGIIKKKGVVVSFYQQEEALKVISDACEVREAYLTILDKNNIVIKEQNSDFQ
VFDYKNFKDLKITLLGTHQIYNASLAVEVIQKLKNIYGYQISEEAIKRGLMNAKWPGRLE
VMKKRPYVVIDGAHNPQGMTVLKESLKLFNYRRLILVIGMLKDKEVDKMLNIITPVADVI
ITTTPLSDRACGAKDLASKISRNSVFAVDQIDKAVNEALKMAGEEDMVLFCGSLYMIGHV
RKLLRGVLNKK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggggcaaatgacatatgaagaggctatccagtacattcacagtacttacaagttcggc
atgaaattaggacttgaaaatataaaaaggcttttaggatatatggggaatcctgaaaaa
aatctcaaaattatccatgtagcagggaccaatggaaaagggtccacttcttcttttata
agcagcattttaaaagaagctggctataaagtggctctttatacttccccttacctggaa
gagtttgaagagaggatgaaaataaatggagaaaatatttccagggaaaagctcgtttac
tatgtagagtacataaagccaataattgcaaggatggtacaggaaggatataatcatcca
acagagtttgaagtcatcactgccattgcttttaaatacttttccgatgaagaagtagac
tttgtggtgctggaagtaggactgggggggagatttgatgccacaaatgctatttcttct
tcactcgtttcagttataacttctattgattatgaccatatggacaagcttggaaatacc
ttaggcgatatagcctatgaaaaagcagggataataaagaagaaaggagttgtagtaagt
ttttaccagcaagaagaggccttaaaagtgattagtgatgcctgtgaggtaagagaagcc
tatttaactatcctggataaaaataatatagtgataaaagagcaaaattcagattttcag
gtttttgattataaaaattttaaggatttgaagataactcttctgggtactcatcagatt
tataatgcttctcttgcggtggaagtcattcaaaaacttaagaatatttatggatatcag
ataagcgaagaggcaataaaaagaggcttaatgaatgcgaagtggcctgggagattagaa
gtcatgaaaaaaaggccgtacgtagtaatagacggtgcacacaatccgcaggggatgaca
gtactgaaagaaagcctgaaattatttaattataggagattaattttggttattgggatg
cttaaagataaagaagtagataaaatgcttaatatcataactcctgtggcagatgtaatt
ataactactactccgctaagcgatagagcctgtggggcaaaagaccttgccagcaaaatt
tctagaaatagtgtgttcgcagtagaccaaattgacaaggcagtgaatgaagcactaaaa
atggcaggtgaagaggatatggtccttttttgtggatctctttacatgataggccatgtg
aggaaattgttaagaggagtactaaataaaaaatga

DBGET integrated database retrieval system