KEGG   Thermoanaerobacter tengcongensis: TTE0817Help
Entry
TTE0817           CDS       T00081                                 

Gene name
AsnB
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tte00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(820533..822374)
Genome map
AA seq 613 aa AA seqDB search
MCGIAGWVNFNMDLSLQNEVIEKMTDTLKKRGPDGSGVWLSKHCVLGHRRLIVIDPQGGI
QPMIKKYGEKNFVIIHNGELYNMDELKNELISLGYTFNTRSDTEIILTSYIEWGPLCVKK
FNGIFAFAIWDEVQNRLFIARDHLGIKPLFYTIKNGSLIFGSEIKAILAHPHVKPEIDSQ
GLAEIFVMGPSRTPGCGVFKDIKELKAGHYLIFTKNGVNISKYWSLQSLPHEDSLEKTAE
KIRYLLKDSSVRQLVSDVPLCSLLSGGLDSTAVSFFANEELKQKGHKLITYSVDYVGNDK
YFTPNEFQPNSDADWVKFVANKLDTDHNYVFIDNEELAHALKPALYARDLPGMADIDSSL
YLFLKEVKKGATVALSGEGADEVFGGYPWFRNKESIRSHTFPWTRMVNERMKLLLPEVVN
YIRPLEYLNDRYNEALNEVPKLNGEDPYNARMREMFYLNITRFMPMLLDRMDRMSMAVGL
EARVPFLDYRLVEYVWNIPWEMKNLNNREKGILRYALKGYIPDEVIERKKSPYPKTHNPV
FKNIVKKWLKQIINDSTSPLLQLVDKKAIAELIETDAKAYDPAWFSQLMGSPQLFAYLVQ
INMWLKDYKISIV
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatagcgggctgggttaactttaatatggacttatcactccaaaatgaagta
atcgaaaaaatgacagacactcttaaaaaaagaggacctgacggttctggggtatggcta
tcaaagcattgtgttttgggtcaccgccgtttaattgttatagatccacaaggcggaatt
caaccaatgataaaaaaatacggtgaaaaaaattttgtcatcatccacaatggagaactc
tacaatatggatgaattaaaaaacgaactcatatccttgggatatacttttaatacccgt
tcagatactgaaattatcttgacatcttatatagaatggggtcctttatgtgttaaaaaa
tttaatggaatatttgcttttgcaatatgggatgaagtacaaaataggctttttattgcc
agggaccatctcggaataaagccactattttataccattaaaaacggatctttgatattt
ggttcagagatcaaagcaatattagcacatcctcatgtaaaaccagagatagactcacaa
ggtcttgcagaaatatttgtaatgggaccttcaagaactcccggatgtggtgtctttaaa
gacattaaagaattaaaagccggacattacctcatatttaccaaaaatggagtaaacata
agcaaatactggtcattacaaagtcttccccatgaagatagccttgagaaaacggcggaa
aaaataaggtatctccttaaagactcatcagtaagacaacttgtttcagacgtaccttta
tgttcattgctctcaggtggacttgattcaactgctgtatctttcttcgcaaatgaagaa
ttaaaacaaaaaggtcataaacttataacatattctgtagattatgtaggtaatgataaa
tattttacgccaaacgaatttcaaccaaactctgacgcagactgggtaaaatttgttgca
aataaacttgacacagaccataactatgtatttatagacaatgaagaactcgcacatgct
ctaaagccagccttatacgctcgagaccttcctggtatggcagatatagactcatcttta
tatctatttttaaaagaagtaaaaaaaggagcaacagtcgccctatcaggagaaggtgct
gatgaagtttttggaggttatccctggtttagaaataaggaatcaatcagaagtcacaca
ttcccatggacaagaatggttaatgaacgcatgaaattgcttctgccagaagttgttaat
tacataaggcctttagaatatctaaatgatagatataacgaagctttaaatgaagtgcca
aagcttaatggagaagacccctataatgctcgaatgagggaaatgttttaccttaacata
acaagatttatgcctatgcttcttgacagaatggatagaatgagtatggcagtaggctta
gaagcaagagtaccttttttagattacagacttgtagaatatgtatggaacataccgtgg
gaaatgaaaaatttaaacaacagagaaaaaggaatacttaggtatgctctaaaaggttac
atcccagacgaagtaattgaaagaaaaaagagtccctaccctaaaacacacaatcctgta
tttaaaaacatcgttaaaaaatggctaaaacaaataattaacgacagtacatccccactt
ttgcaacttgtagataaaaaagcaattgcagaacttatagaaacagatgcaaaagcctat
gaccctgcctggttttcacagcttatgggttccccacagcttttcgcttacctcgtacaa
ataaatatgtggttgaaagattataaaatttctatagtgtaa

DBGET integrated database retrieval system