KEGG   Thermoanaerobacter tengcongensis: TTE1035Help
Entry
TTE1035           CDS       T00081                                 

Gene name
CheB
Definition
methylesterase CheB/methylase CheR
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:tte00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    TTE1035 (CheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    TTE1035 (CheB)
Enzymes [BR:tte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     TTE1035 (CheB)
Two-component system [BR:tte02022]
 CheA family
  CheA-CheYBV
   TTE1035 (CheB)
Bacterial motility proteins [BR:tte02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    TTE1035 (CheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1041694..1042797
Genome map
AA seq 367 aa AA seqDB search
MKKKIRVLVVDDSAFMRRCLKDILENEEDMEVIDTARDGNEAVKKAVELRPDVITLDINM
PVMDGLTALQYIMSLAPCPVVIISSLSTEGALTTFEALELGAVDFVAKPGGTVSLGIKQL
ADEIVSKVRIAALSNKELLSSSRNFKKLLKRRNQEVTRKVYENKISKKEIVVVIGVSTGG
PKTLMEILPYLPSDFPAAVLVVQHMPPGFTQSFAQRLDQSCNLKVKEAEDKAFIEPGTVI
IAKGGWHLVVERDSRSSKLITRLTQKPEETLYKPSINVTMKSVLENVDGRNIIGILLTGM
GDDGADMMVEIRKRGGLTIAESQETAIVYGMPRAAVERGGAEIVAPAYKISDILLKKVNE
YARTSEY
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaaattcgcgtactcgtagtggatgactctgcttttatgcggaggtgttta
aaggatatacttgaaaatgaggaagacatggaagtaattgataccgctcgtgatggcaat
gaggcagtaaagaaggcagtagaacttcgccctgatgtgataactcttgatataaatatg
ccagtaatggatgggcttactgcgctgcagtacataatgtctcttgcgccatgtcctgtt
gtaattatttcatctctttctacagaaggagctttaaccacatttgaagctctcgaactt
ggagctgttgattttgtggcaaaaccaggaggcacagtttcgctgggaataaagcagctt
gcagacgaaattgtatcaaaagtgaggatagctgccttatctaataaggagctactaagt
tcttcaagaaactttaaaaagttattgaaacgtagaaatcaggaagtaactaggaaagta
tatgaaaataaaatttctaaaaaagaaattgtggtagtaattggagtttctacaggggga
ccgaaaacattgatggaaattttaccttatcttccttcagattttccggcagctgtgttg
gtagttcagcacatgccgccaggttttacccaatcttttgctcaacgtctagatcaaagc
tgcaatttaaaggtaaaggaagcggaagacaaagcgtttatagaacctggaacagttatc
attgcaaaaggtggatggcaccttgtggtggaaagagattcaagaagttctaagcttatt
actagattaactcagaagcctgaagagacactttataagccttctattaatgttaccatg
aaatcggtacttgaaaatgtagatggccggaatattataggtatacttttgacgggtatg
ggtgacgacggtgcagatatgatggttgaaataagaaaacgaggtggattaactattgca
gaatcacaagaaactgctatagtatatggtatgccaagagcagctgtagagcgtggtgga
gctgagatagtggcacctgcttataagataagtgatatcttgttaaagaaggtgaatgag
tatgcaagaacctcagaatattaa

DBGET integrated database retrieval system