KEGG   Thermoanaerobacter tengcongensis: TTE1035Help
Entry
TTE1035           CDS       T00081                                 

Gene name
CheB
Definition
methylesterase CheB/methylase CheR
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:tte02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:tte02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1041694..1042797
Genome map
AA seq 367 aa AA seqDB search
MKKKIRVLVVDDSAFMRRCLKDILENEEDMEVIDTARDGNEAVKKAVELRPDVITLDINM
PVMDGLTALQYIMSLAPCPVVIISSLSTEGALTTFEALELGAVDFVAKPGGTVSLGIKQL
ADEIVSKVRIAALSNKELLSSSRNFKKLLKRRNQEVTRKVYENKISKKEIVVVIGVSTGG
PKTLMEILPYLPSDFPAAVLVVQHMPPGFTQSFAQRLDQSCNLKVKEAEDKAFIEPGTVI
IAKGGWHLVVERDSRSSKLITRLTQKPEETLYKPSINVTMKSVLENVDGRNIIGILLTGM
GDDGADMMVEIRKRGGLTIAESQETAIVYGMPRAAVERGGAEIVAPAYKISDILLKKVNE
YARTSEY
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaaattcgcgtactcgtagtggatgactctgcttttatgcggaggtgttta
aaggatatacttgaaaatgaggaagacatggaagtaattgataccgctcgtgatggcaat
gaggcagtaaagaaggcagtagaacttcgccctgatgtgataactcttgatataaatatg
ccagtaatggatgggcttactgcgctgcagtacataatgtctcttgcgccatgtcctgtt
gtaattatttcatctctttctacagaaggagctttaaccacatttgaagctctcgaactt
ggagctgttgattttgtggcaaaaccaggaggcacagtttcgctgggaataaagcagctt
gcagacgaaattgtatcaaaagtgaggatagctgccttatctaataaggagctactaagt
tcttcaagaaactttaaaaagttattgaaacgtagaaatcaggaagtaactaggaaagta
tatgaaaataaaatttctaaaaaagaaattgtggtagtaattggagtttctacaggggga
ccgaaaacattgatggaaattttaccttatcttccttcagattttccggcagctgtgttg
gtagttcagcacatgccgccaggttttacccaatcttttgctcaacgtctagatcaaagc
tgcaatttaaaggtaaaggaagcggaagacaaagcgtttatagaacctggaacagttatc
attgcaaaaggtggatggcaccttgtggtggaaagagattcaagaagttctaagcttatt
actagattaactcagaagcctgaagagacactttataagccttctattaatgttaccatg
aaatcggtacttgaaaatgtagatggccggaatattataggtatacttttgacgggtatg
ggtgacgacggtgcagatatgatggttgaaataagaaaacgaggtggattaactattgca
gaatcacaagaaactgctatagtatatggtatgccaagagcagctgtagagcgtggtgga
gctgagatagtggcacctgcttataagataagtgatatcttgttaaagaaggtgaatgag
tatgcaagaacctcagaatattaa

DBGET integrated database retrieval system