KEGG   Thermoanaerobacter tengcongensis: TTE1179Help
Entry
TTE1179           CDS       T00081                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tte03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1177702..1178265
Genome map
AA seq 187 aa AA seqDB search
MIEYIRGIIEDIGPDHVIIDLMGIGIKIFVPFSTMKELPPKGNITKLYTYLYVREDGFQI
FGFKRKEELELFEKLLSVSGVGPKGALSILSVVPIESFIKAVNSGDYKILTAAPGIGKKT
AERIILELKDKVPKEVVVPKEDSLLNEALEALLALGYTKSEAIYALSDVNCESVEQAVKE
ALKKLAK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgattgagtacataaggggaattattgaagacataggaccagatcatgtgataatcgac
cttatgggcataggtataaaaatttttgtgcccttttctactatgaaggagttgcctccc
aaaggaaatataacaaagctttacacatacctttacgtcagggaagatggatttcagatt
tttggctttaagagaaaagaagagctagaactttttgagaaattactttctgtgagcggc
gtaggacctaaaggtgctctttctattctctctgttgtgccaatagaaagctttataaag
gcagtaaacagcggtgattacaaaattttaacagcagctcctggcataggaaagaagaca
gcagagaggatcatattagagctcaaggataaagtgcccaaagaggttgtagtcccgaaa
gaggacagcctgttaaatgaggctttagaggctttgctagcattgggttatactaaaagt
gaggctatttacgctctttctgatgtaaactgtgaaagtgtggaacaggctgtcaaagag
gcgctgaaaaaattggcgaaatag

DBGET integrated database retrieval system