KEGG   Thermoanaerobacter tengcongensis: TTE1179Help
Entry
TTE1179           CDS       T00081                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tte00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TTE1179 (ruvA)
Enzymes [BR:tte01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     TTE1179 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1177702..1178265
Genome map
AA seq 187 aa AA seqDB search
MIEYIRGIIEDIGPDHVIIDLMGIGIKIFVPFSTMKELPPKGNITKLYTYLYVREDGFQI
FGFKRKEELELFEKLLSVSGVGPKGALSILSVVPIESFIKAVNSGDYKILTAAPGIGKKT
AERIILELKDKVPKEVVVPKEDSLLNEALEALLALGYTKSEAIYALSDVNCESVEQAVKE
ALKKLAK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgattgagtacataaggggaattattgaagacataggaccagatcatgtgataatcgac
cttatgggcataggtataaaaatttttgtgcccttttctactatgaaggagttgcctccc
aaaggaaatataacaaagctttacacatacctttacgtcagggaagatggatttcagatt
tttggctttaagagaaaagaagagctagaactttttgagaaattactttctgtgagcggc
gtaggacctaaaggtgctctttctattctctctgttgtgccaatagaaagctttataaag
gcagtaaacagcggtgattacaaaattttaacagcagctcctggcataggaaagaagaca
gcagagaggatcatattagagctcaaggataaagtgcccaaagaggttgtagtcccgaaa
gaggacagcctgttaaatgaggctttagaggctttgctagcattgggttatactaaaagt
gaggctatttacgctctttctgatgtaaactgtgaaagtgtggaacaggctgtcaaagag
gcgctgaaaaaattggcgaaatag

DBGET integrated database retrieval system