KEGG   Thermoanaerobacter tengcongensis: TTE1277Help
Entry
TTE1277           CDS       T00081                                 

Gene name
ProB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tte01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:tte00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1272895..1274013
Genome map
AA seq 372 aa AA seqDB search
MRIVVKVGTSTLTHENGKLNLEIMEKLVRQIANLSNKGEEVILVTSGAIGAGMGKLNLTE
KPKNLPQKQALAAIGQGLLIEIYEKFFNEYGKITAQLLLTREDFSDRKRYLNMSYTLSNL
LKWGVIPVINENDTVAVEEIKIGDNDTLAALVASLVEADLLIILTDIDGLFDKDPRIYKD
AKVIEVVEEFSDDLFKIAGGAGTKRGTGGMYTKIQAAKICYNSGVKMVIANGKIDNVLNR
IAAGEKIGTTFLPMKNPISSRKIWIAFNAKVNGFLFVDEGAAKALVKHGKSLLPSGIVKT
EGQYDVGDCVAVVDHQGREIARGLVNYSSEEVEKIKGCKTHDIESILGYKYYDEVIHRDN
LVVLERGEKYGG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaggattgtagttaaggttgggactagtactttgactcatgaaaatgggaaattgaat
ttagaaataatggaaaaactagtaagacaaatcgcaaatttgtcaaataaaggagaagaa
gttatacttgtgacgtctggggcgattggagctggaatgggaaaattaaacttgacagaa
aagcccaaaaaccttccgcaaaagcaggccctagcagccattggtcaaggtctccttata
gagatttacgagaaatttttcaacgaatacgggaaaataactgcccagcttcttttgacg
agggaggactttagtgacagaaaaaggtatttaaatatgagctacaccctctctaacctt
ctcaagtggggagtcatacctgtgataaatgaaaatgacactgtggcagtagaggagata
aagattggggataatgataccctggcagcccttgtggcaagccttgttgaagcagacctt
ttgattattttgactgatatcgatggcctttttgacaaggacccgagaatttataaggat
gctaaggttatagaagtggttgaggagttttctgatgacctttttaaaatagctggcggg
gcaggtacaaaaagaggaacaggaggaatgtacacaaagattcaggcagccaagatatgc
tacaattcgggagttaaaatggtgattgcaaatggcaaaattgacaatgtattaaataga
attgcagcaggagaaaaaattgggactacttttcttcccatgaaaaatcctataagcagc
agaaaaatctggattgctttcaatgcaaaggtgaatggttttttgtttgtagatgaaggg
gcagcaaaggctttagtaaagcatggaaaaagcttactgccaagcggtattgtaaagaca
gaaggccagtatgacgttggggactgcgtggcagtggtggaccaccagggcagggaaata
gctagagggcttgtcaactattcttctgaggaagtcgaaaaaataaaaggctgtaagacc
catgacatagagtcaatattggggtataagtactacgacgaggttattcacagggacaat
ctcgtagttcttgagagaggtgagaagtatggaggttga

DBGET integrated database retrieval system