KEGG   Thermoanaerobacter tengcongensis: TTE1335Help
Entry
TTE1335           CDS       T00081                                 

Gene name
SpeB
Definition
arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:tte00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1319639..1320520
Genome map
AA seq 293 aa AA seqDB search
MMRCKMGERVNFIDTGKFLTATKEYEEADIVLVGVPMDYSVSFKPGTRFGPSSIRQASYG
LETYSVYLDRRLEDKKICDLGDLVLPYGNIEKSLRLIEEVAEKIVKDGKKGIFLGGEHLI
TYGILKSYIKKYGDKLAILHFDAHTDLREEFFDEPYSHATVLRKVWELSPKVKIYHFGIR
SGEKEEFEFAEKNTNMFLYEVVEPLKNVMKEIKENFIYITFDIDVLDPAFAPGTGTPEPG
GITAKEALEAIHLLKDFNVIGMDLVEVSPPYDVAGITSILAAKLVREAILSFF
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgatgaggtgtaaaatgggagagagagtaaatttcatagatacaggaaagtttttaacc
gctactaaggaatatgaggaggcagacattgtcttggtaggggtacctatggattacagc
gtcagctttaagcctggtacccgctttggtccttcttctataaggcaggcctcctatggg
cttgaaacttacagcgtttaccttgacaggcgcttagaagacaaaaaaatatgtgatttg
ggagatttggtgctgccttatggaaatatagagaaaagcttgagattaattgaggaagtt
gctgaaaaaatagtcaaagatggaaaaaagggcattttcttaggcggagagcatttgatt
acttatgggattttaaaaagttatataaaaaaatacggagataagttggctattttacac
tttgacgctcacacagacctaagagaagaattttttgatgagccctattcccacgctact
gtattaagaaaagtatgggaactaagccctaaagttaaaatatatcactttggcataagg
tctggagaaaaagaggagtttgaatttgccgaaaaaaatacaaatatgtttttgtatgag
gtggtagaacctctaaaaaatgtgatgaaggagataaaagaaaattttatatacataacc
tttgatatagacgtattagatcctgcttttgcaccagggactggaacgccagaacccggt
gggataacggcaaaagaggccttagaagccatccaccttttaaaagattttaatgtgata
gggatggatttagtagaagtatctcctccttatgacgtcgcaggtattacatctatactt
gcggcaaaacttgtaagagaagctattctctctttcttttaa

DBGET integrated database retrieval system