KEGG   Thermoanaerobacter tengcongensis: TTE1577Help
Entry
TTE1577           CDS       T00081                                 

Gene name
TrpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TTE1577 (TrpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TTE1577 (TrpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TTE1577 (TrpA)
Enzymes [BR:tte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TTE1577 (TrpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1534296..1535084)
Genome map
AA seq 262 aa AA seqDB search
MNRIDRRFDDLKKEGKKALITFITAGDPDIDTTYDIVLALEEAGADIIELGIPYSDPLAD
GPTIQASSQRALAKGIKIKDIMDLVMRIREKSDIPIVYLVYYNSVFKYGIEKFLEDSKNA
GVDGLIIPDLPLEERKEVLDVADKYEIYLIPLVAPTSKERIKGITENGKGFVYCVTLTGV
TGAREEITTDLEEYMRLVSSYTSMPKALGFGISGPEMARKLKSLSDGIVVGSAIVERIAK
GYNRCEMLKEVKEFVLSLREVL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgaatagaattgatagaaggtttgatgacctcaaaaaagaaggtaaaaaagcccttata
actttcattactgccggagacccagacattgacacaacttatgatatagttttagccctt
gaagaagcaggagcggatataattgaacttggtataccctattctgaccccttggccgat
gggccgacaatccaagcttcttcccagagagctttggctaagggaataaaaattaaagat
ataatggatttggtaatgagaataagagaaaagagcgacattcctattgtctatcttgtt
tattacaactctgtcttcaaatacggcatagagaagtttttggaggattcgaaaaacgca
ggagttgatggactcattattcccgacctccctttggaggagaggaaagaagtcttggat
gtagctgataagtacgaaatttatttaatacctctggtagctcctacttcaaaggagaga
ataaagggaattactgaaaacggtaagggatttgtatactgcgtgactctgactggagtt
acgggagcgagggaggaaattacaacagaccttgaggaatacatgaggctggtatcttca
tataccagcatgccaaaggctttagggtttggcatatcaggacccgaaatggcaagaaag
cttaaaagtttgagcgatggaattgtggtaggaagcgctattgtagaaagaattgctaag
gggtataatagatgtgaaatgttaaaagaggtaaaggaatttgtgttaagcttaagagaa
gtcttgtga

DBGET integrated database retrieval system