KEGG   Caldanaerobacter subterraneus subsp. tengcongensis: TTE1592Help
Entry
TTE1592           CDS       T00081                                 

Gene name
AraD
Definition
(GenBank) Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tte  Caldanaerobacter subterraneus subsp. tengcongensis
Pathway
tte00051  Fructose and mannose metabolism
tte01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    TTE1592 (AraD)
Enzymes [BR:tte01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     TTE1592 (AraD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AAM24796
UniProt: Q8R9L5
Position
complement(1548769..1549416)
Genome map
AA seq 215 aa AA seqDB search
MLLKYEREQIVEYGKKLIDTNLTRGTGGNLSVYDYKSGLMAITPSGMDYYELKAEDILVM
DLEGKVVEGTKVPSTEYEMHRIFYVRRDDIKAIIHTHPVYTTTLACLHWDLPPVHYLIAL
AGPDVKCAKYATFGTKELAENAFEAMKGRKAVLLANHGLLVGAEDLPNAFNISIQIEYVA
ELYYRAKSIGEPVLLSSEEMELMMEKFKTYGQVRK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtgcttttaaaatatgagagagaacaaatagtagagtacggcaaaaagctcatagataca
aatctcaccagaggtacagggggaaatttaagtgtttatgactataaaagtggacttatg
gctataactccttcgggaatggactattatgaattaaaagctgaagacatattggtgatg
gatttagagggaaaagttgtagaagggacaaaggttccttctactgagtacgagatgcac
aggattttttatgtaagaagagatgacataaaagcaattattcacactcatcctgtctat
actactactctagcttgtcttcactgggacctgccccctgttcattacctaatagctttg
gcaggacctgatgtaaaatgcgctaaatacgctacttttggtactaaggaacttgctgag
aacgcttttgaggcaatgaaaggcagaaaagctgttttgctagctaatcacgggcttcta
gttggtgctgaagaccttccgaatgccttcaatataagtatacagatcgagtatgtagca
gaactttactatagagcaaaatctataggcgaacctgtgcttttatcttctgaagagatg
gagcttatgatggagaagtttaaaacttatgggcaggtaagaaaataa

DBGET integrated database retrieval system