KEGG   Thermoanaerobacter tengcongensis: TTE1746Help
Entry
TTE1746           CDS       T00081                                 

Gene name
ArgE2
Definition
(GenBank) Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
tte00300  Lysine biosynthesis
tte01100  Metabolic pathways
tte01120  Microbial metabolism in diverse environments
tte01230  Biosynthesis of amino acids
Module
tte_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    TTE1746 (ArgE2)
Enzymes [BR:tte01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     TTE1746 (ArgE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AAM24940
UniProt: Q8R5R5
Position
complement(1692199..1693593)
Genome map
AA seq 464 aa AA seqDB search
MDLNSYIDSMRDEIIKSVQELVRIKSVQDEPKPGMPYGEGVARALEKALEIAERLGFKTK
NLDGYIGYAEYGEGEEMIAVLGHLDVVPEGDGWTYPPYGAEIHDGKIYGRGTVDDKGPII
AALYGLKAIKDAGLKLSKRVRIIFGTNEETGSHEIKYYLEHDEAPTMGFTPDAQYPIIHA
EKGITMFNVVKDFNKKPSRIVVKYIKGGERPNVVPGYCEARLKVEEENTKKEILNELEAF
VRETGYDLKFEEKEGDLVIKSFGIPAHGSLPHLGKNAIMQLFLFLDRINLDESDVKDFIH
FFATNVGMETNGKTFGIYLKDETGELTFNVGTVSIDEDKGVLGLNIRYPVKHKYEDWMNI
FEEKIKGQGMRIEDMLHQPPLYFPPDHPLIKILSKVYEEQTGQKAELLAIGGGTYAKEMP
NTVAFGPVFPGKPELAHQADEYIEIEDLILNAKIYAHAIYELAK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggatttaaactcttacatagacagcatgagggatgaaatcataaaatccgttcaggaa
ttagtcagaataaaaagcgtgcaggatgaaccgaaaccaggtatgccgtacggagaaggc
gttgcaagagcgctagagaaagcgcttgaaattgcagaaaggttgggatttaaaactaag
aacctggacggctatatagggtatgcagagtacggtgaaggagaagaaatgattgcagtg
ctggggcacctggatgtagtgcctgaaggggatgggtggacatatccgccctatggagct
gagatacacgacggaaagatatatgggagaggtactgtggacgacaaagggccaataatc
gctgctttatatggcctaaaagccataaaagatgcaggccttaagctttcgaaaagagtg
aggattattttcgggactaatgaagaaacagggtcccatgagataaaatattatctggaa
cacgatgaagctcccacaatgggctttactcctgatgcacagtacccgattatacatgca
gaaaaaggaataacaatgttcaatgtggtcaaagattttaataaaaagccaagtagaata
gtggtaaaatacatcaaaggtggagaaaggcccaatgtggtccccggttactgtgaggcg
aggcttaaggttgaagaggaaaataccaagaaagagattttgaatgaattagaagctttt
gtaagagaaacggggtatgaccttaaatttgaggagaaggaaggcgatttagtaataaag
tcttttgggatacctgcccatggaagccttccacatctcgggaaaaacgcaataatgcaa
ctattcctctttttggatagaataaatttagatgaaagcgatgtgaaggactttatacac
ttctttgcgacgaatgttggcatggagactaatggcaaaacttttggaatatacctaaaa
gatgagacaggagagctcacctttaatgtgggaactgtttcgatagatgaggacaaggga
gtattgggattgaatataagatatcctgtcaagcacaagtatgaagactggatgaacatt
tttgaggagaagataaaaggtcagggtatgagaatagaggatatgctgcaccagccgcct
ttgtatttcccacctgatcatcccttgataaagattttaagtaaggtttatgaagagcag
acgggacagaaagcagagcttttggctataggtggtggaacttatgccaaagaaatgccg
aatactgtagcttttggtcctgttttcccaggaaaaccagagctggctcatcaggctgat
gagtacatagaaattgaagacctgatattaaacgcaaaaatttacgctcacgcaatatat
gaacttgccaaataa

DBGET integrated database retrieval system