KEGG   Thermoanaerobacter tengcongensis: TTE1760Help
Entry
TTE1760           CDS       T00081                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TTE1760 (tpiA)
   01230 Biosynthesis of amino acids
    TTE1760 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTE1760 (tpiA)
   00051 Fructose and mannose metabolism
    TTE1760 (tpiA)
   00562 Inositol phosphate metabolism
    TTE1760 (tpiA)
Enzymes [BR:tte01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TTE1760 (tpiA)
Exosome [BR:tte04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TTE1760 (tpiA)
  Exosomal proteins of bladder cancer cells
   TTE1760 (tpiA)
  Exosomal proteins of melanoma cells
   TTE1760 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1707322..1708068)
Genome map
AA seq 248 aa AA seqDB search
MRRPIIAGNWKMHKTPSEAVKLVEELIPLVKDAKAEVVVIPPFVDLTEVARVIKGTNILL
GAQNMFWEEKGAYTGEISPVMLKEIGVTYVVIGHSERRQYFKETDEMVNKKVLSALSHDL
KPIVCVGESLSQREEGKTYDVVLTQTREALKGVSEEDITKVVIAYEPVWAIGTGKNATPQ
DANEVIKAIRNTIAELYGKDKAEMVRIQYGGSVKPDNISGFMAESDIDGALVGGASLVAE
DFAKIVNY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
ttgagaaggcctataattgcaggaaattggaaaatgcataagaccccttcagaggcagtg
aaattggtagaagagctgattcctctagtaaaagatgcaaaagccgaagtagtagtaatt
cccccttttgtagatttgacagaagttgctagagtcataaaaggtactaatatattgctg
ggagcacaaaacatgttctgggaagaaaagggggcttacacaggagaaatttcacctgta
atgctaaaagaaataggagtaacttatgtggtaattggccattctgaaagaaggcagtat
tttaaagagacagatgaaatggtgaataaaaaagtgttgtctgccctttcacacgattta
aaacctatcgtctgtgtaggagaatctctttctcaaagagaggaaggaaaaacttacgat
gtagttttaactcagacaagggaagctttaaaaggcgtatctgaggaagatataacaaaa
gtagtcatcgcttatgagcctgtttgggcaatagggacgggtaaaaatgctactccacag
gacgccaatgaggttataaaagctataaggaatacaatagcagaactttatgggaaagat
aaggctgaaatggtgagaatacagtacggaggaagtgtgaaacctgataacatctctggt
ttcatggcagaaagcgatatagacggagctttggttggcggtgccagccttgtggctgag
gattttgcaaagattgtgaattactaa

DBGET integrated database retrieval system