KEGG   Caldanaerobacter subterraneus subsp. tengcongensis: TTE1760Help
Entry
TTE1760           CDS       T00081                                 

Gene name
TpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tte  Caldanaerobacter subterraneus subsp. tengcongensis
Pathway
tte00010  Glycolysis / Gluconeogenesis
tte00051  Fructose and mannose metabolism
tte01100  Metabolic pathways
tte01110  Biosynthesis of secondary metabolites
tte01120  Microbial metabolism in diverse environments
tte01130  Biosynthesis of antibiotics
tte01200  Carbon metabolism
tte01230  Biosynthesis of amino acids
Module
tte_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tte_M00002  Glycolysis, core module involving three-carbon compounds
tte_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTE1760 (TpiA)
   00051 Fructose and mannose metabolism
    TTE1760 (TpiA)
   00562 Inositol phosphate metabolism
    TTE1760 (TpiA)
Enzymes [BR:tte01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TTE1760 (TpiA)
Exosome [BR:tte04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TTE1760 (TpiA)
  Exosomal proteins of bladder cancer cells
   TTE1760 (TpiA)
  Exosomal proteins of melanoma cells
   TTE1760 (TpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AAM24954
UniProt: Q8R966
Position
complement(1707322..1708068)
Genome map
AA seq 248 aa AA seqDB search
MRRPIIAGNWKMHKTPSEAVKLVEELIPLVKDAKAEVVVIPPFVDLTEVARVIKGTNILL
GAQNMFWEEKGAYTGEISPVMLKEIGVTYVVIGHSERRQYFKETDEMVNKKVLSALSHDL
KPIVCVGESLSQREEGKTYDVVLTQTREALKGVSEEDITKVVIAYEPVWAIGTGKNATPQ
DANEVIKAIRNTIAELYGKDKAEMVRIQYGGSVKPDNISGFMAESDIDGALVGGASLVAE
DFAKIVNY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
ttgagaaggcctataattgcaggaaattggaaaatgcataagaccccttcagaggcagtg
aaattggtagaagagctgattcctctagtaaaagatgcaaaagccgaagtagtagtaatt
cccccttttgtagatttgacagaagttgctagagtcataaaaggtactaatatattgctg
ggagcacaaaacatgttctgggaagaaaagggggcttacacaggagaaatttcacctgta
atgctaaaagaaataggagtaacttatgtggtaattggccattctgaaagaaggcagtat
tttaaagagacagatgaaatggtgaataaaaaagtgttgtctgccctttcacacgattta
aaacctatcgtctgtgtaggagaatctctttctcaaagagaggaaggaaaaacttacgat
gtagttttaactcagacaagggaagctttaaaaggcgtatctgaggaagatataacaaaa
gtagtcatcgcttatgagcctgtttgggcaatagggacgggtaaaaatgctactccacag
gacgccaatgaggttataaaagctataaggaatacaatagcagaactttatgggaaagat
aaggctgaaatggtgagaatacagtacggaggaagtgtgaaacctgataacatctctggt
ttcatggcagaaagcgatatagacggagctttggttggcggtgccagccttgtggctgag
gattttgcaaagattgtgaattactaa

DBGET integrated database retrieval system