KEGG   Thermoanaerobacter tengcongensis: TTE1813Help
Entry
TTE1813           CDS       T00081                                 

Definition
hypothetical protein
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tte00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1760198..1762309)
Genome map
AA seq 703 aa AA seqDB search
MLKRIGILLIFIVIGVFVLSGCSDVSYVKVEHLDKTEASQGPGERDTWATAQKQGIGTAN
NDVSKVWFTLAQGALSEIYYPTIDRANSKFLKFIVTDGKTFVADETTDTVSKVEKINNRS
LAYRLVNIDKRGRYKITKEIFTDPRRNSVVMKVRFEALKGKMEDYKLYLVYDPHISNQGA
DNEGYVVKANGEYGFMACRNNVYSALMTDAKWGSYSVGYNGVNDPVSDLKKNKKMTYKFD
RAKGNIIEGIEIDLRDKTEFKTVLSFGESEEEALKTALSTLKDSYDRMLGIYIAEWNKYC
DGLKNFGGEADELYYTSLMFLKASEDKTNKGAFIASLSIPWGEGQGDENKGGYHLVWARD
LYHIANAFIAAKDIDSANRALDFLAMVVEKNGFMPQNTWINGDPYWNGIQMDEQADPIIL
AYHLKRYDLYEKLVKPLADFIVRVGPKTGQERWEEAGGYSPATMAAEVAGLVCAADIAKQ
NKDMERAKKYLETADKWQELIDKLTYTTKGPYGNGQYYIRIAGLPDPDADFLISIANGGG
VYDQKEIVDPSFLELVRLGVKAYDDPKILNTISVVDSLLKVNTPKGPSWYRYNHDGYGEP
AKGELYHGKGKGRLWPLLTGERGMYEIAAGKKADDYLEYMRNFANEGFVLSEQIWEDTGL
PTDSASPLNWAHAEYVVLFASNIEGKVVDMPQIVYKRYVLGER
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
gtgttgaagaggattggaattttgttgatttttatagtgattggagtttttgtcctttca
gggtgttctgatgtttcatacgtgaaggttgaacatttagataaaaccgaagcttctcaa
ggaccaggggagagagatacatgggcgacagctcaaaaacagggcattggcactgccaat
aatgatgtatcgaaagtatggtttactttagctcagggggccctttctgagatttactat
cctaccattgacagagccaacagcaagtttttaaaatttattgttactgatggcaaaact
tttgtggctgatgagacaactgacactgtaagcaaggtagagaagattaacaacaggtct
ttagcttacaggctagtgaatattgataaaagaggaaggtataaaattacaaaagagata
tttactgacccaagaaggaattctgttgtcatgaaggtgagatttgaagcgttaaaaggg
aaaatggaagattataaactttatcttgtgtacgaccctcatatttctaatcaaggagcg
gataatgaggggtatgttgtaaaagcgaatggtgaatacggatttatggcttgtagaaac
aatgtgtattcagccttaatgactgatgcgaaatgggggagctattctgtaggatataac
ggtgttaatgaccctgtgagcgatttaaagaaaaataagaaaatgacttacaagttcgat
agggctaaagggaatataattgagggtattgagattgatttaagagacaagacggaattt
aaaaccgttctttcctttggagaaagtgaggaagaggcgttaaagacggctcttagtact
ttaaaagacagttacgacaggatgcttgggatatatatagcagaatggaataaatactgc
gacgggcttaaaaactttggtggagaggcagacgagctttactataccagtttaatgttt
ttaaaggcgagtgaagataaaaccaacaaaggagcttttattgcctccctttcaattcca
tggggagaaggacagggggatgagaataaaggagggtatcacttagtttgggcaagagat
ttataccacatcgccaatgcttttattgcagctaaagatatagattcggctaatagggct
ttggattttctagctatggtggtagaaaaaaatggatttatgcctcaaaacacttggata
aacggagacccttactggaacgggattcagatggacgaacaggctgacccgataatcctg
gcatatcaccttaaaagatacgatttgtatgaaaaattggtaaaaccccttgctgatttt
atagtaagagtaggacctaagacaggacaagagaggtgggaggaagcgggagggtattct
cctgccactatggcagctgaagttgctggacttgtctgtgctgctgatattgcgaagcaa
aacaaagatatggaaagggcaaagaaatatctggagacagctgacaaatggcaagagttg
atagacaaactcacttatactacgaaaggaccttatggcaatgggcagtattatataaga
attgcaggtttaccggacccggatgccgactttttaataagcattgccaacggaggagga
gtgtatgaccagaaggagattgtagatccaagttttttagagcttgtaaggttaggagta
aaagcttatgatgacccaaagatattgaatactatttcggtagttgatagcctccttaaa
gtaaatactcctaaagggccttcgtggtacaggtacaatcatgatggctatggtgaaccc
gccaaaggagaactttatcatggcaaaggtaaaggcagattatggcctcttcttacagga
gagagagggatgtacgaaattgcagcagggaaaaaagcagatgactatctagagtatatg
agaaattttgctaatgaaggttttgtcttgtcagagcaaatttgggaagatacaggactt
cctacagattctgcttctcctctcaattgggctcatgcggaatatgtggtgctttttgca
tctaacatagaagggaaggtagttgatatgccacaaattgtatacaaaaggtatgtatta
ggggagagataa

DBGET integrated database retrieval system