KEGG   Caldanaerobacter subterraneus subsp. tengcongensis: TTE1816Help
Entry
TTE1816           CDS       T00081                                 

Gene name
PfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tte  Caldanaerobacter subterraneus subsp. tengcongensis
Pathway
tte00010  Glycolysis / Gluconeogenesis
tte00030  Pentose phosphate pathway
tte00051  Fructose and mannose metabolism
tte00052  Galactose metabolism
tte00680  Methane metabolism
tte01100  Metabolic pathways
tte01110  Biosynthesis of secondary metabolites
tte01120  Microbial metabolism in diverse environments
tte01130  Biosynthesis of antibiotics
tte01200  Carbon metabolism
tte01230  Biosynthesis of amino acids
tte03018  RNA degradation
Module
tte_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTE1816 (PfkA)
   00030 Pentose phosphate pathway
    TTE1816 (PfkA)
   00051 Fructose and mannose metabolism
    TTE1816 (PfkA)
   00052 Galactose metabolism
    TTE1816 (PfkA)
  Energy metabolism
   00680 Methane metabolism
    TTE1816 (PfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TTE1816 (PfkA)
Enzymes [BR:tte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TTE1816 (PfkA)
Protein phosphatases and associated proteins [BR:tte01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TTE1816 (PfkA)
Messenger RNA biogenesis [BR:tte03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TTE1816 (PfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: AAM25008
UniProt: Q8R914
Position
complement(1764656..1765621)
Genome map
AA seq 321 aa AA seqDB search
MKTIGILTSGGDAPGMNAAIRAVVRTGIYYGLKVKGIMRGFAGLVEDEVIDLGLSSVGDI
IQKGGTILRTARCEEFKQKEVRKKAYETLQKHGIEGLVVIGGDGSFRGAQLLSEEWNVNT
ICIPGTIDNDIPCTDYTIGFDTACNTVIDAINKIRDTATSHERANIIEVMGRNSGYIALY
AGVAGGAEMIILPEVEWSIDELCDKITYGIKRGKLHHIIVLAEGVMSAPELAKMIKERLP
KLDLRYTILGHIQRGGAPTVMDRVLASQMGARAVELLLENKTKRVISIRNNQIVDDDIDE
ALSMKKEFNRKLYELSKILSI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgattggaatacttacaagcggtggagatgctcctggcatgaatgcagctata
agggctgtggtgaggacaggaatttactacggccttaaggtaaagggtattatgagagga
tttgcaggtcttgtagaagatgaagtgatagatttggggctttcttcagtaggagatatt
atacaaaaaggtgggacaatcttaaggactgctcgttgcgaggagttcaagcaaaaagag
gtgagaaaaaaggcatacgagactttgcagaaacatggaattgaaggattggttgtaatc
ggaggagatggttccttcagaggtgctcagcttcttagcgaagagtggaatgtcaatacg
atttgtatacctggcactattgacaatgacatcccttgtacagattatactattggattt
gatacagcctgcaacactgtgattgatgctataaataaaataagagatacagcaacttcc
catgagagagcgaatataatagaggtcatgggtagaaattcagggtacatcgccctttac
gctggtgtggctggtggagcggagatgataattttgcctgaagtggaatggagtatagat
gaattatgtgataaaataacttatggaataaagagaggaaaacttcaccacataatcgta
ttggcagagggagtaatgagcgccccagaactggcaaaaatgataaaagaaaggcttccc
aagttagacttaaggtacaccatattaggacatattcaaagagggggagctcccactgtg
atggacagagttttggcaagtcagatgggagcaagggcagtggagcttcttttggagaac
aagacgaagagagtaataagcataagaaacaatcaaattgttgacgatgatatagatgaa
gcgctttcaatgaagaaagagtttaacagaaagctttacgaactcagcaaaatcctctct
atataa

DBGET integrated database retrieval system