KEGG   Thermoanaerobacter tengcongensis: TTE1832Help
Entry
TTE1832           CDS       T00081                                 

Gene name
AmyA2
Definition
glycosidases
Orthology
K00701  
cyclomaltodextrin glucanotransferase [EC:2.4.1.19]
Organism
tte  Thermoanaerobacter tengcongensis
Brite
Enzymes [BR:tte01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.19  cyclomaltodextrin glucanotransferase
     TTE1832 (AmyA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1781977..1783551)
Genome map
AA seq 524 aa AA seqDB search
MRKNLKAFVALFAAILLFFSGCSSKQEAKAPKSEVIYQVMVDRFYNGDPSNDDPEVSKGM
FDPTHTNWRMYWGGDLKGLTEKIPYIKGMGVTAIWISPVVDNINKPAVYNGEINAPYHGY
WARDFKRVEEHFGTWEDFDNFVKVAHENGIKVILDFAPNHTSPADEENPDFAENGALYDD
GKLLGTYSNDSLKLFHHNGSISNWNNLKELQDKNLFDLADLDQSNPIVDKYLKDSIKLWF
NHEIDGVRLDAAKHMPMEWVKSFANTIYSIKKDVLLFGEWMLSGPTDPLYGYNIQFANTT
GFSVLDFMLNGAIRDVFGKGYGFERLNDTLEDTNKDYENPYKLVAFIDNHDMPRFLSLNN
DKDKLHEAIAFVMTTRGIPVIYYGTEQYLHNDTNGGNDPYNRPMMEKFDESTKAYTLIKE
LSRLRQLTPALQYGTTTARYISDDVYIYERQYGKDVVLVAINKGEKTTVKAVKTSLRKGI
YKDYLKGLLEGVELKVTKGNGENLVQGLTLPGDSVSVWTNVKAK
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaatttaaaagcatttgtggcgctttttgcagcaattttgctgttctttagt
gggtgcagtagcaagcaagaggcaaaagccccaaagtcagaagtcatatatcaggttatg
gtggataggttttacaacggagacccttcaaatgacgacccagaagtgagcaaaggaatg
tttgaccccacccataccaactggaggatgtactggggaggggatttgaaaggactgaca
gaaaaaatcccttatataaaggggatgggggtcactgctatctggatttctccagtagtg
gataatataaataaaccagccgtatataatggcgagattaatgccccctatcacggatac
tgggcaagagatttcaaaagagtagaagaacactttggtacatgggaggactttgacaat
tttgtaaaggttgcgcatgagaatggaataaaagtgattttagattttgcgccaaatcac
acgagccctgccgatgaagaaaatcctgattttgcagaaaatggcgcattatatgacgat
gggaagctattaggtacttacagtaatgattcacttaagctttttcaccacaatggcagc
ataagcaactggaataatttaaaggaacttcaggataaaaatttgtttgatttggcagat
ttggaccagagcaaccctattgttgataaatacttaaaagactctattaagttatggttt
aatcatgaaattgatggagtaaggctggatgctgcaaagcatatgcctatggagtgggtg
aaaagctttgctaacactatttacagtattaaaaaggatgtgcttctttttggtgaatgg
atgttaagcggtcctactgacccgttgtatgggtataatatacagtttgctaatactacc
ggcttttctgtcctggattttatgttaaacggtgctataagagatgtatttggcaagggg
tacggatttgagaggttaaatgacacgttagaggataccaataaagattacgaaaatcct
tataagctggttgcttttatagacaaccatgacatgcctagatttctgtccttgaacaat
gacaaggataaattacacgaagctattgcttttgtaatgacgactcgagggatacctgta
atatactatggcactgagcagtaccttcataacgacacaaatggcggtaatgacccgtat
aatagaccaatgatggaaaagttcgatgagagcacaaaggcttatacattgataaaagag
ctgtcaaggttaaggcagctcactccagccctacagtatggaactactacggcaaggtat
atttctgacgatgtgtatatttatgaaaggcagtatggaaaagatgtggtgctggttgcg
ataaataaaggagagaaaactactgttaaggcagtaaaaacatctttgaggaagggaatt
tataaagactaccttaaaggtctgttggagggtgttgagttaaaagtcacaaaaggcaat
ggagaaaacctagtgcaaggtttgactttacctggggacagcgtaagtgtgtggacaaat
gtgaaagcgaagtaa

DBGET integrated database retrieval system