KEGG   Thermoanaerobacter tengcongensis: TTE1961Help
Entry
TTE1961           CDS       T00081                                 

Gene name
NagC4
Definition
transcriptional regulator
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TTE1961 (NagC4)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTE1961 (NagC4)
   00052 Galactose metabolism
    TTE1961 (NagC4)
   00500 Starch and sucrose metabolism
    TTE1961 (NagC4)
   00520 Amino sugar and nucleotide sugar metabolism
    TTE1961 (NagC4)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TTE1961 (NagC4)
   00524 Butirosin and neomycin biosynthesis
    TTE1961 (NagC4)
Enzymes [BR:tte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TTE1961 (NagC4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1906019..1906957)
Genome map
AA seq 312 aa AA seqDB search
MRIGVDLGGTNIAVGLVEEDGKIIATGSRPTKPERGYEAIARDIAELSFELLQRMGISVK
DVKSMGIGVPGVADNEKGIVIRAVNLFWTKVPLAKEIRKYIDLPIYMENDANVAALAEAT
FGAGRGSKSSVTITLGTGVGSGFILDGKIYSGAHHFAPEIGHMVIGDNGIRCNCGKIGCF
ETYASATALIREGKKAAKRNPNTLILKFANGDIEGITAKNVIDAAKQYDEEALKIFEEYV
KYLAVGIVNIINLFDPEVIILGGGVANAGDFLLKPLKKEVAENILFKELPYADIRKAELG
NDAGIIGAAILS
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaggataggtgttgaccttggaggaacaaacatagcagttggcttggtagaagaggat
ggcaagataattgctacaggtagcaggcctaccaagcctgagagaggatatgaggcaatt
gcaagagacatagcagaactgagttttgagcttcttcaaaggatgggaataagcgtaaaa
gacgtaaaatccatgggaattggtgttccaggagttgcggacaatgaaaagggaatagtg
ataagagcagtaaatttgttctggacaaaagtgcctctggcgaaggagataagaaaatac
attgatttgccgatatatatggaaaatgatgcaaatgtggcggcactagcagaggctact
tttggagcagggaggggttcaaagtcttctgtgacaatcactttagggacaggagttggc
tccggatttatactggatgggaagatttacagcggcgctcatcactttgctccggagata
ggtcacatggtcataggggataatggcataaggtgtaactgcggcaaaattggctgcttt
gaaacctatgcctctgctactgcattgataagggaagggaaaaaagctgctaagagaaat
cccaatactctgattttaaaatttgcaaatggcgatattgagggcattactgctaaaaat
gtgatagacgctgcaaaacaatatgatgaggaggctctaaagatttttgaggaatatgta
aaatatttggcagttgggattgtaaacataataaacctgtttgacccggaagtaataata
ttaggtggcggggttgcaaatgcgggagatttcctcttaaagcctctcaaaaaagaagtg
gcagaaaatatactctttaaagaacttccctatgctgacataagaaaggctgagcttgga
aatgatgccggcataattggtgccgctatattaagttaa

DBGET integrated database retrieval system