KEGG   Caldanaerobacter subterraneus subsp. tengcongensis: TTE2109Help
Entry
TTE2109           CDS       T00081                                 

Gene name
RecD2
Definition
(GenBank) ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
tte  Caldanaerobacter subterraneus subsp. tengcongensis
Pathway
tte03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:tte00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TTE2109 (RecD2)
Enzymes [BR:tte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     TTE2109 (RecD2)
DNA repair and recombination proteins [BR:tte03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     TTE2109 (RecD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 AAA_11 Viral_helicase1 DUF2075 T2SSE HHH_5 Helicase_RecD PhoH PIF1 CbiA AAA_5 UvrD_C AAA_22 UvrD-helicase RsgA_GTPase AAA_29 AAA_16 TrwB_AAD_bind Herpes_Helicase AAA_28 HHH_2 AAA_18 HHH NTPase_1 AAA DEAD SMC_N SRP54 AAA_25 Zeta_toxin DUF2213 ArgK cobW AAA_14
Motif
Other DBs
NCBI-ProteinID: AAM25278
UniProt: Q8R8A3
Position
complement(2030600..2032771)
Genome map
AA seq 723 aa AA seqDB search
MIENLQEIKNCTIEKIIFTSNDGYTVAAVRTEDNNFVATFQGSYKQGQKLDLIGEWYVHS
KYGRQFRVVFAEISKDADEDDIEIFLQSIKGIGPVRARKIVAAFKKHTIQVIEKNPEKLR
EIGIPQKVVDSVNAEITQNKEFNEIKLELLLLGFSLNMIKKLYDRYGSNTLLQVKANPYK
IAEEVDGIGFIKADEIARKFGIEQDNAYRIQSGLKYTLYLAETEGHLYLPITTLCKAASE
KILKVGYTKVLDQALYLTAAQELYDDEGKVYLPKNFYNEKYIAEKIAKMLNEKPWRINNI
DELIKEAEAAKNIRYSPKQKEAIKKAVENNISIITGGPGTGKTTIVSALLYIFQKQDKLV
ALASPTGKAAKRLEEVTIYPAKTIHRLLEARFDKEFRSVRFFRNENNPLDEDVVIIDEFS
MVDNELAASLFKALRKDTKLVIIGDMDQLPSVGAGNVLRDLIESGIIPVTKLDVIFRQGE
TSGIILNSKLIREGKMVRFNNKDFIFHELVKPEQVVDEFIKELEKGKTLDDVQILTPMKK
TDIGTLELNRLIQERINPPHPQKEEIAYGSKIFRVGDKVMQTQNNYEKEIFNGDTGYVKR
AYRDEEGLRHVVIDFDGRIVDLVEEELKEIIPAYAITIHKSQGSEYDTVIVVLAMNHYIM
LKRNLLYTAVTRAKNVVKIFGDMQAIKIAINTIDSSKRYTALKERLKNVKEYAERGILYA
LEI
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaaacctgcaggaaatcaaaaactgcacaattgaaaaaattattttcacatca
aacgacggttatacagttgcagctgtccgaacagaagacaataactttgttgcaaccttt
cagggcagttacaaacagggacagaagctggatttgataggagaatggtacgtccattcg
aaatacggcagacagttcagagttgtattcgcagaaatatcaaaagacgcagatgaggac
gatatagaaatttttctccaaagcataaaaggcataggcccggtaagggcaaggaaaata
gtcgcagcatttaaaaaacataccatacaggttattgaaaaaaaccccgaaaagctcaga
gaaattgggataccacagaaggtagttgattcagtaaatgctgaaattacgcagaacaaa
gagttcaacgaaataaagcttgagcttctgcttttaggattttcgctgaacatgataaaa
aagctttatgaccgctacggcagtaatacactcctgcaggtaaaagcgaatccctacaaa
attgcagaagaagttgacggaataggctttattaaagccgatgaaatagccagaaaattt
ggcatagagcaggataatgcctacaggattcagtcaggcttaaaatatacgctgtacctt
gccgaaacagaaggacacttatacctgccgattacaacactgtgcaaagcagcatcggag
aagattttaaaagtagggtacacaaaagttttagatcaggctctgtatttaacagctgca
caggagctttatgacgatgaagggaaagtgtacctgcctaaaaatttttacaacgaaaag
tacattgctgagaaaattgctaagatgctcaatgaaaagccctggagaataaacaacatt
gatgagcttatcaaagaagcagaggctgcaaaaaacatcagatacagtccaaaacagaaa
gaagccataaaaaaggcggttgaaaacaacatatccatcataactggagggccgggcaca
ggaaaaacgacgattgtcagcgctcttctatatattttccaaaaacaagataagcttgtg
gctttagcatctccaacaggcaaagcagcaaaaaggcttgaagaagtaacaatctacccg
gcaaaaacgatccacagactgctggaggcaaggtttgataaagaatttaggagtgtaaga
ttttttagaaacgaaaataatcctcttgatgaggatgttgttattattgatgaattctca
atggttgacaatgaacttgctgcaagtttatttaaagccttgaggaaagatacaaagctt
gtcataataggagacatggatcagcttccatcagtaggcgcaggaaacgtcttaagagac
ttaattgagtcgggtataatacctgtaacaaaacttgacgttattttcaggcagggagaa
acgtcagggataatcctcaactcgaaactcataagagaagggaaaatggtgcgatttaat
aacaaagattttatctttcatgaacttgtaaagcctgagcaggttgtagatgagtttata
aaagaacttgaaaaaggcaaaacacttgatgatgtgcagattttaacaccaatgaaaaag
acagacatagggacgctggagttgaacaggctgatacaggaacgaataaatccaccacat
ccccagaaagaggaaatagcatacggcagcaaaatattcagagttggagataaagtcatg
cagactcaaaacaactacgaaaaagaaatcttcaatggcgacacgggctatgtaaaaaga
gcttacagagacgaagaaggtctaaggcatgttgtgatagattttgatgggcgaatagtc
gatctggtagaggaagagttaaaagaaataattcctgcctatgcaatcacaatccataag
tcgcagggcagtgagtacgatactgtaatcgtggtacttgcaatgaaccactacatcatg
cttaaaagaaaccttctgtacactgctgtcacaagagctaaaaacgttgttaaaatcttt
ggagacatgcaggctataaaaatagctataaacacaattgacagctcaaagaggtatacg
gctctaaaggagagattgaaaaacgtgaaggagtatgctgaaaggggaattttatatgct
ctggagatataa

DBGET integrated database retrieval system