KEGG   Thermoanaerobacter tengcongensis: TTE2109Help
Entry
TTE2109           CDS       T00081                                 

Gene name
RecD2
Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tte00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TTE2109 (RecD2)
Enzymes [BR:tte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     TTE2109 (RecD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2030600..2032771)
Genome map
AA seq 723 aa AA seqDB search
MIENLQEIKNCTIEKIIFTSNDGYTVAAVRTEDNNFVATFQGSYKQGQKLDLIGEWYVHS
KYGRQFRVVFAEISKDADEDDIEIFLQSIKGIGPVRARKIVAAFKKHTIQVIEKNPEKLR
EIGIPQKVVDSVNAEITQNKEFNEIKLELLLLGFSLNMIKKLYDRYGSNTLLQVKANPYK
IAEEVDGIGFIKADEIARKFGIEQDNAYRIQSGLKYTLYLAETEGHLYLPITTLCKAASE
KILKVGYTKVLDQALYLTAAQELYDDEGKVYLPKNFYNEKYIAEKIAKMLNEKPWRINNI
DELIKEAEAAKNIRYSPKQKEAIKKAVENNISIITGGPGTGKTTIVSALLYIFQKQDKLV
ALASPTGKAAKRLEEVTIYPAKTIHRLLEARFDKEFRSVRFFRNENNPLDEDVVIIDEFS
MVDNELAASLFKALRKDTKLVIIGDMDQLPSVGAGNVLRDLIESGIIPVTKLDVIFRQGE
TSGIILNSKLIREGKMVRFNNKDFIFHELVKPEQVVDEFIKELEKGKTLDDVQILTPMKK
TDIGTLELNRLIQERINPPHPQKEEIAYGSKIFRVGDKVMQTQNNYEKEIFNGDTGYVKR
AYRDEEGLRHVVIDFDGRIVDLVEEELKEIIPAYAITIHKSQGSEYDTVIVVLAMNHYIM
LKRNLLYTAVTRAKNVVKIFGDMQAIKIAINTIDSSKRYTALKERLKNVKEYAERGILYA
LEI
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaaacctgcaggaaatcaaaaactgcacaattgaaaaaattattttcacatca
aacgacggttatacagttgcagctgtccgaacagaagacaataactttgttgcaaccttt
cagggcagttacaaacagggacagaagctggatttgataggagaatggtacgtccattcg
aaatacggcagacagttcagagttgtattcgcagaaatatcaaaagacgcagatgaggac
gatatagaaatttttctccaaagcataaaaggcataggcccggtaagggcaaggaaaata
gtcgcagcatttaaaaaacataccatacaggttattgaaaaaaaccccgaaaagctcaga
gaaattgggataccacagaaggtagttgattcagtaaatgctgaaattacgcagaacaaa
gagttcaacgaaataaagcttgagcttctgcttttaggattttcgctgaacatgataaaa
aagctttatgaccgctacggcagtaatacactcctgcaggtaaaagcgaatccctacaaa
attgcagaagaagttgacggaataggctttattaaagccgatgaaatagccagaaaattt
ggcatagagcaggataatgcctacaggattcagtcaggcttaaaatatacgctgtacctt
gccgaaacagaaggacacttatacctgccgattacaacactgtgcaaagcagcatcggag
aagattttaaaagtagggtacacaaaagttttagatcaggctctgtatttaacagctgca
caggagctttatgacgatgaagggaaagtgtacctgcctaaaaatttttacaacgaaaag
tacattgctgagaaaattgctaagatgctcaatgaaaagccctggagaataaacaacatt
gatgagcttatcaaagaagcagaggctgcaaaaaacatcagatacagtccaaaacagaaa
gaagccataaaaaaggcggttgaaaacaacatatccatcataactggagggccgggcaca
ggaaaaacgacgattgtcagcgctcttctatatattttccaaaaacaagataagcttgtg
gctttagcatctccaacaggcaaagcagcaaaaaggcttgaagaagtaacaatctacccg
gcaaaaacgatccacagactgctggaggcaaggtttgataaagaatttaggagtgtaaga
ttttttagaaacgaaaataatcctcttgatgaggatgttgttattattgatgaattctca
atggttgacaatgaacttgctgcaagtttatttaaagccttgaggaaagatacaaagctt
gtcataataggagacatggatcagcttccatcagtaggcgcaggaaacgtcttaagagac
ttaattgagtcgggtataatacctgtaacaaaacttgacgttattttcaggcagggagaa
acgtcagggataatcctcaactcgaaactcataagagaagggaaaatggtgcgatttaat
aacaaagattttatctttcatgaacttgtaaagcctgagcaggttgtagatgagtttata
aaagaacttgaaaaaggcaaaacacttgatgatgtgcagattttaacaccaatgaaaaag
acagacatagggacgctggagttgaacaggctgatacaggaacgaataaatccaccacat
ccccagaaagaggaaatagcatacggcagcaaaatattcagagttggagataaagtcatg
cagactcaaaacaactacgaaaaagaaatcttcaatggcgacacgggctatgtaaaaaga
gcttacagagacgaagaaggtctaaggcatgttgtgatagattttgatgggcgaatagtc
gatctggtagaggaagagttaaaagaaataattcctgcctatgcaatcacaatccataag
tcgcagggcagtgagtacgatactgtaatcgtggtacttgcaatgaaccactacatcatg
cttaaaagaaaccttctgtacactgctgtcacaagagctaaaaacgttgttaaaatcttt
ggagacatgcaggctataaaaatagctataaacacaattgacagctcaaagaggtatacg
gctctaaaggagagattgaaaaacgtgaaggagtatgctgaaaggggaattttatatgct
ctggagatataa

DBGET integrated database retrieval system