KEGG   Thermoanaerobacter tengcongensis: TTE2138Help
Entry
TTE2138           CDS       T00081                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tte01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:tte00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2053862..2055154)
Genome map
AA seq 430 aa AA seqDB search
MIEMFDFTKEVDIGIFNKIQNRSKLENKEIAKRVEDIIENVRERKDKALFEYTYMYDGIN
LNSETVKVKEEEIKRAYEEVKEDFLKALDKAIKNITEFHEKQKEKTWMDFKEGIVYGQVL
RPLSSVGIYVPGGTASYPSSVLMNGIPAKVAGVERIVMVSPAGKKGISPYVLVAADKIGI
KEIYKIGGAQAVAALAFGTESIPKVDKIVGPGNIYVAMAKRALYGYVDIDMVAGPSEILV
IADESASPKYVAADLLSQAEHDVMASSILVTTSKELAEKVKKEIERQMEYLERKEIIAES
LKNFGAIIVIDNLKEAIGIANEIAPEHLELVIENPFEILGEIKNAGAVFLGEFSPEPLGD
YLAGPNHVLPTSGTARFFSPLSVRDFVKKMNVLYYSKEALSSVKDDVITLAEAEELTAHA
NSVKVRFYND
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaatgtttgattttactaaggaagtcgatatagggatttttaataaaatacag
aatagaagtaaattggagaataaagagattgcaaaaagggttgaagacataatagaaaat
gtgagagagaggaaggataaagcgttatttgaatacacctatatgtatgatggaataaat
ctcaatagcgagacagtgaaggtaaaagaggaagaaataaaaagagcttatgaggaagtg
aaagaggattttttaaaagcgttagataaggccataaaaaatattacggagtttcatgag
aagcaaaaggaaaagacatggatggattttaaagaaggaatagtttacgggcaagtatta
aggcctctttcctctgtaggcatttatgttcctggaggaactgcctcatatccttcttca
gttttgatgaatggtattcctgcaaaggtggcaggcgttgaaagaatagtaatggtatct
cctgctggaaaaaaggggataagcccttatgtgcttgtggcggcagataaaattggaata
aaagaaatatataaaattggcggagcacaggctgttgcagcactggcttttggcacagaa
tcaatacctaaggtggacaaaatagttggtccaggaaatatttatgtagcaatggcaaaa
agagccctatatggctatgtagacatagacatggtggcaggacctagtgaaattttggta
attgcagatgagtcagcaagtccaaaatatgtagcagcagaccttctttcacaggcagaa
cacgatgtaatggcttcttcaatattagtgacaacctcaaaagagttagcggaaaaagta
aaaaaagaaattgaaagacaaatggaatatcttgagcgaaaagaaataattgcagagtct
ttaaaaaattttggcgcgataattgttatagataatttaaaagaagcaattggtattgca
aatgaaatagctccagagcatttagagcttgtcattgaaaatccttttgaaattttaggc
gaaattaaaaatgcaggagcagtatttttaggagaattttctccagaacctttgggagac
taccttgcaggtccaaatcatgttcttcctacaagtggtacagcgagatttttctctcct
ctttcagttagggattttgtcaaaaagatgaatgtactttattactctaaggaagctttg
agcagtgtaaaagatgatgtcataaccttggcagaagctgaagagcttacagcccatgcc
aattctgtaaaagtgaggttttacaatgattga

DBGET integrated database retrieval system