KEGG   Thermoanaerobacter tengcongensis: TTE2308Help
Entry
TTE2308           CDS       T00081                                 

Gene name
SecE
Definition
preprotein translocase subunit SecE
Orthology
K03073  
preprotein translocase subunit SecE
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Protein export
Bacterial secretion system
Module
Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:tte00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    TTE2308 (SecE)
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    TTE2308 (SecE)
Secretion system [BR:tte02044]
 Sec (secretion) system
  Bacterial Sec-SRP core components [MD:M00335]
   TTE2308 (SecE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2191276..2191476)
Genome map
AA seq 66 aa AA seqDB search
MAGEGRKIVKFFREVKAEMKKVTWPGRDTMITYTEVVLVVMVLFTIFIFLVDSVFSYILK
LILKSF
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atggccggtgaaggaaggaagattgtaaagttttttagagaagtaaaggcagaaatgaaa
aaagtgacgtggcccggaagggatacgatgataacttatacggaagttgtgctcgttgta
atggtcctctttacgatatttatttttttggtagattctgtttttagctatatattgaaa
ctcatcctcaaatcattttaa

DBGET integrated database retrieval system