KEGG   Thermoanaerobacter tengcongensis: TTE2348Help
Entry
TTE2348           CDS       T00081                                 

Definition
O-glycosyl hydrolase family protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tte00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:tte00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2234814..2236145
Genome map
AA seq 443 aa AA seqDB search
MKITGYVTARDYNIPFSKLEKIEKADTKRPDSFVKIYPDEELEEVIGFGGALTEAAAFNI
LSLPEEKQEKILKAYFDEKEGLGYKLVRIHMNSCDFSLESYSCDDVEGDVELKHFNIERD
KKWVIPLLKKIKRYVPDLKVLVSPWSPPAWMKTNNDMKYGGKLKEEYKKTWAEFFVKFIK
AYQEEGIDIWAVTVQNEPMAVQIWESCIYTAEEERDFVKYYLGPTLLENGLSHIKILIWD
HNKDIIYERVKTILEDKEAAKYVWGVGFHWYAGDHFEQLKKIKEEFPHIKLVFTEGTQEG
GVNLGSWNLGERYAHEIIGDFNNYTIGFFDWNIVLDTMGGPNHVKNYCDAPIIVDTEKKE
IFYQSSYYYIGHFSKFIKPGSKTIKSEILDPRLEILSAKTPEGKIIVVVMNKTEENIDIL
LDIGGDLYNAPSIKKSIETFVIN
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaagattaccgggtatgtaactgcaagagattataatattcctttttcaaaacttgaa
aaaatagaaaaagcagatacaaaaaggccagactcttttgtaaaaatataccctgatgaa
gaattagaagaagtaatagggttcggaggcgctttaactgaagctgctgccttcaatata
ctaagccttcctgaggaaaaacaagagaaaatattaaaagcctattttgatgaaaaagaa
ggattaggctacaagctcgtcagaattcatatgaatagctgcgatttttcattagagagc
tacagctgtgatgatgtggaaggagatgtggagttaaagcacttcaacatagaaagagat
aaaaaatgggtaatacctcttttaaagaaaataaaacgctatgtccctgacctaaaagtg
cttgtctccccttggagtcctcccgcatggatgaagacaaataacgatatgaaatacgga
ggaaaattaaaagaagaatacaaaaagacgtgggcagaattttttgttaaatttataaaa
gcctatcaggaagaaggtattgacatatgggctgtcacagttcaaaatgagccaatggct
gtgcaaatatgggaatcctgcatatacaccgctgaagaagaaagagactttgtaaaatac
tatttaggaccaactcttttagaaaacggcctttctcatatcaagattcttatatgggac
cataacaaagacataatatacgaaagagtaaaaactatcttagaagataaagaagctgca
aaatacgtctggggtgtaggctttcactggtacgcaggagaccattttgaacaattaaaa
aagataaaagaagaattccctcacataaaactagtatttacagaaggaacccaagaggga
ggagtaaacttgggttcctggaatcttggtgaaagatatgcccatgaaataataggcgat
tttaacaactacacaatcggcttttttgactggaatatagtattagatacaatgggagga
cctaatcacgtcaaaaactactgcgatgctcctatcattgtggatacagagaaaaaagaa
attttttaccaaagttcctactactatatagggcatttttccaaattcataaagcccggg
tcaaaaacaataaaatctgaaatccttgacccaaggttagaaatcctttcagccaaaact
cctgagggtaaaataattgtggtggtaatgaataaaacggaagaaaatatagatatactt
cttgatataggcggtgacctttataatgcaccctctattaaaaagtctattgaaactttt
gtaattaattaa

DBGET integrated database retrieval system