KEGG   Caldanaerobacter subterraneus subsp. tengcongensis: TTE2369Help
Entry
TTE2369           CDS       T00081                                 

Gene name
FolK
Definition
(GenBank) 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tte  Caldanaerobacter subterraneus subsp. tengcongensis
Pathway
tte00790  Folate biosynthesis
tte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TTE2369 (FolK)
Enzymes [BR:tte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     TTE2369 (FolK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: AAM25508
UniProt: Q8R7N4
Position
complement(2259425..2259925)
Genome map
AA seq 166 aa AA seqDB search
MTEVYLSLGSNLGDREKYLKEAVKRLKSNKNIVLKKLSPIYETKPVGYLEQDNFLNAAIL
IETDLTPYELLDVTTSIEAELKRERTIKWGPRTIDIDILLYDGLILNDEKLTIPHPHMWE
RAFVLIPLRDINPSLSKNGLSIDELIQGLIDKQGVWLYKKDWCGEV
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgacagaggtatacctttctttgggttcaaatttaggagatagagaaaagtatttaaaa
gaggcggtcaaaaggcttaagtcaaataaaaacatagttttaaagaagctctctcccata
tatgagacaaagcctgtaggatatttagaacaggacaattttttaaacgctgcaatttta
atagaaacagacctaacgccctatgaacttctagatgtcactacaagtattgaggcagaa
ctcaaaagagagcgcacaataaaatggggaccccgaaccattgacatagacattcttttg
tatgatggacttattctaaatgatgagaagctaactattcctcatcctcacatgtgggaa
agagcttttgtgctgataccattaagggatataaatccttcattgagtaaaaacggttta
tccatcgatgagttgatacaaggccttatagacaagcagggcgtatggctctacaaaaag
gattggtgtggagaggtgtaa

DBGET integrated database retrieval system