KEGG   Caldanaerobacter subterraneus subsp. tengcongensis: TTE2370Help
Entry
TTE2370           CDS       T00081                                 

Gene name
FolP
Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
tte  Caldanaerobacter subterraneus subsp. tengcongensis
Pathway
tte00790  Folate biosynthesis
tte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TTE2370 (FolP)
Enzymes [BR:tte01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     TTE2370 (FolP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AAM25509
UniProt: Q8R7N3
Position
complement(2259922..2260734)
Genome map
AA seq 270 aa AA seqDB search
MILKCRDKTLEIGKRTYIMGILNMTPDSFSDGGKYNTLEKGIERALQMIEEGADIIDVGG
ESTRPGYTPVDEEEEIRRVIPVIERLSKISDVIISVDTMKANVALRALEAGAHIVNDVWG
LQRDPKMAEVVAKYKAGVVMMHNSNVAEYGDVVKSIIEFLKKSIEIAEKAGIERNQMIVD
PGIGFGKTLEHNLEVMNRLEELKVLGLPVLLGTSRKSMIGKVLNVDVEDRLEGTAATVAV
GIVKGVDIIRVHDVKEMSRVAKMTDAMVRR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgattttaaagtgcagggataagactttagagattggcaaaaggacctacataatgggt
attttgaacatgactcctgattccttttcagacggaggcaaatacaatactttggaaaaa
gggattgaaagagctttgcagatgattgaagagggagcagatataatagatgtaggagga
gagtctacaaggcccggatacactcctgtcgatgaagaggaagaaattagaagggttata
cctgtaatcgaaaggctttctaaaatttcagatgtgataatttctgtggatactatgaag
gcgaatgtagctttaagggcgctggaggcaggagcccatatagtaaatgatgtgtggggg
cttcagagagaccccaagatggcagaagtagttgccaaatataaagcaggggttgtcatg
atgcacaacagcaatgtggctgagtacggcgatgtagtaaaatctatcatagaatttttg
aaaaagagcatagaaattgctgagaaagctggaattgaaagaaaccagatgatagttgac
cctggcataggctttggaaagactttagagcataatttggaagtcatgaatcgcctggag
gaattaaaagttctgggacttcctgtccttttgggtacttccagaaaatctatgataggc
aaagtcttaaacgtagatgtagaggatagattggaggggacagcggcgactgtagctgtg
ggaatagtaaaaggagtggatataataagagtccacgatgtaaaagagatgtcaagagta
gctaaaatgactgatgcgatggtgagaagatga

DBGET integrated database retrieval system