KEGG   Thermoanaerobacter tengcongensis: TTE2487Help
Entry
TTE2487           CDS       T00081                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TTE2487 (gpmA)
   01230 Biosynthesis of amino acids
    TTE2487 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTE2487 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    TTE2487 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TTE2487 (gpmA)
Enzymes [BR:tte01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TTE2487 (gpmA)
Exosome [BR:tte04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TTE2487 (gpmA)
  Exosomal proteins of melanoma cells
   TTE2487 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2374021..2374770)
Genome map
AA seq 249 aa AA seqDB search
MYKVVLLRHGESIWNMENRFTGWTDVDLSPKGIEEAKQAGKILKEKGFTFDAAFTSVLKR
AIRTLWIVLDELDLMWIPVYKSWRLNERHYGALQGLNKAETAKKYGEEQVKLWRRSAEVR
PPALTKDDPRYPGNDPRYADLSEDEIPLTENLIDTINRVIPYWESTIAPTIKSGKRVIIA
AHGNSLRGLVKYLDNLSNEEIMELNIPTGIPLVYELDENLKPIRHYYLADEEELKKKQQE
VAEQGKARA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaagtagttttacttcgccatggagaaagcatatggaacatggaaaacaggttc
acaggttggacagatgtagacctttcgccgaaaggaattgaagaggcaaagcaggcagga
aagattttgaaagagaagggatttacttttgatgcggcgtttacttcagttttgaagagg
gcaataaggactttgtggatagttttagatgagctggacctcatgtggataccagtttac
aagtcctggcggttgaatgagaggcattatggagctcttcaggggcttaataaggcagaa
accgcaaaaaaatatggagaagagcaggtaaagctttggagaaggtctgcagaggttaga
cctcctgctttgactaaggatgacccgagatatcctggcaatgacccaaggtacgccgac
ctttctgaggatgaaattcctctcacagagaatttgatagacactataaatagagttatt
ccctactgggagtccacaattgcaccgactataaagtctggcaagagagtgataatagca
gctcatggaaacagtttaagaggccttgtgaagtatctggacaatctttctaatgaggaa
ataatggagctaaatattcctacaggtattcctctggtttatgagttagatgagaactta
aagcctataaggcactattatttagctgatgaagaggagctcaagaaaaaacagcaggaa
gttgcggagcagggcaaagcgagggcttaa

DBGET integrated database retrieval system