KEGG   Caldanaerobacter subterraneus subsp. tengcongensis: TTE2559Help
Entry
TTE2559           CDS       T00081                                 

Gene name
IspE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate synthase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tte  Caldanaerobacter subterraneus subsp. tengcongensis
Pathway
tte00900  Terpenoid backbone biosynthesis
tte01100  Metabolic pathways
tte01110  Biosynthesis of secondary metabolites
tte01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TTE2559 (IspE)
Enzymes [BR:tte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     TTE2559 (IspE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AAM25683
UniProt: Q8R765
Position
complement(2447075..2447938)
Genome map
AA seq 287 aa AA seqDB search
MKLRIKAYAKVNLTLDVLSKREDGYHEILSVMQSIDLADVIEFEKAKEILFECDHERVPK
GEENLIMKAFNAIRDRYFLNEGIKIKLFKNIPLAAGLAGGSADAAATIVALDKLWNLNLT
EKEMEEIASEVGSDVPFCLKGGTKLASGRGEKLQDLEGIPLNLLLVKPDLEISTKEVYTE
WDNSGFKSLNSTFLFVEALKKGDLLEIARNISNDLERVTSQKYRVIEDIKKSLIEKGALS
ASMTGSGPTVYGVFNDVEKLVRAYHDLKGVYPFVAISKTIDKGLEIL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttagaataaaggcctatgcaaaagtaaatctcacgcttgacgttttgtcaaag
agggaagatggatatcatgaaattttaagtgtgatgcagtcaattgacctggctgatgtg
attgaatttgagaaagcaaaggaaattttgtttgaatgcgaccatgagagagttcccaaa
ggagaagaaaacctcataatgaaggcttttaatgcgataagagataggtattttttaaat
gaaggtataaaaataaagctttttaaaaatattcctttggctgccggccttgctggagga
agtgcagatgctgctgctacaattgtagcattagataagctctggaatttaaaccttaca
gaaaaagagatggaagaaatagcgtcagaagtagggtctgacgtgcctttctgccttaag
ggaggaacaaagcttgctagtggaagaggagaaaagcttcaagatttagagggaattcct
ttgaatttgcttcttgtcaagcctgatttagaaatttctacaaaagaagtttacactgaa
tgggataattccgggtttaaaagcttaaactctacttttttatttgttgaggctttgaag
aagggggatttattagaaattgctaggaatataagcaatgaccttgaaagagtgacctct
caaaagtatagagtgattgaagatataaagaaaagtttgatagagaaaggagctctatct
gcttctatgacaggaagcggtcctacggtatacggtgtttttaatgatgttgaaaagctt
gtaagggcttatcatgaccttaagggagtttatccttttgttgccatttctaaaactata
gacaaggggttagaaatattatga

DBGET integrated database retrieval system