KEGG   Thermoanaerobacter tengcongensis: TTE2619Help
Entry
TTE2619           CDS       T00081                                 

Gene name
ThrC2
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tte00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TTE2619 (ThrC2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TTE2619 (ThrC2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TTE2619 (ThrC2)
Enzymes [BR:tte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TTE2619 (ThrC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2511829..2512884)
Genome map
AA seq 351 aa AA seqDB search
MAYEGIIKAYREFLPPIRDENIVTLKEGNTPLIEAFNLQRKYLPGIRVYLKYEGLNPTGS
FKDRGMTVAVSQAKQEGSNAVVCASTGNTSASAAAYAAKAGLKSVVLIPGGKIALGKLAQ
AIAYGAEVIAVDGNFDDALRLVREISQKFPITLVNSINPYRLEGQKTAAFEICDALGEVP
DYVSLPVGNAGNITAYWMGFKEYYRKGKIKKLPKMLGFQAAGAAPIVEGRVIENPETIAT
AIRIGNPASWQKAVAARDESGGIIDKVTDEEILEAYSILAKTEGIFAEPASAASIAGVIK
KYKEGFFKEGDSVVCILTGNGLKDPDTAVKLGGEVKRIQPNLKELEEVLYG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacgaaggaattataaaagcttatagagagtttttgcctcctataagagatgaa
aatattgtcacgttaaaagagggcaacacacctttaattgaagcttttaacctccaaaga
aaatatttgccgggtataagggtgtatctaaaatacgaagggctaaatcccacaggttct
tttaaggacagggggatgacggtagcggtatctcaagcaaagcaagaagggtctaatgcc
gtcgtatgcgcctcaacaggcaacacttctgcttctgcagcagcctatgcagcaaaagca
ggccttaaaagtgtggtattaattcctggcggtaaaattgctctggggaaactcgcacag
gcaattgcttatggggcagaggttattgcggtagatggcaattttgatgacgctttaagg
cttgtgagagaaatttcgcagaaattcccgattactttggtaaattctataaacccctat
cgcctggaaggccaaaaaacggcagcttttgaaatatgtgatgctttgggagaagtacca
gactatgtctctcttcctgtgggcaatgcaggaaatataactgcttactggatgggattt
aaagaatactaccggaaggggaagataaaaaagcttcccaaaatgcttggctttcaggcg
gcaggagcggctcctattgtggaaggaagagtaatagaaaatcccgagacgattgccacg
gctataagaattggcaaccctgccagctggcagaaggcagtggctgcaagagatgagtcg
ggggggataattgacaaagttacggatgaggaaatactggaggcttattcaattttggca
aaaacagaggggatttttgcagagccagcctctgcagcctccatagcgggtgtgataaag
aagtacaaagaaggattttttaaagaaggagattctgtggtgtgtatccttacggggaat
ggtttaaaagaccctgatactgctgttaaactagggggagaggtaaagagaatacagcca
aatctaaaggaattggaggaagttttgtatggatag

DBGET integrated database retrieval system