KEGG   Thermoanaerobacter tengcongensis: TTE2679Help
Entry
TTE2679           CDS       T00081                                 

Gene name
TyrS
Definition
tyrosyl-tRNA synthetase (EC:6.1.1.1)
Orthology
K01866  
tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
tte  Thermoanaerobacter tengcongensis
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:tte00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    TTE2679 (TyrS)
Enzymes [BR:tte01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     TTE2679 (TyrS)
Amino acid related enzymes [BR:tte01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   TTE2679 (TyrS)
Transfer RNA biogenesis [BR:tte03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    TTE2679 (TyrS)
 Prokaryotic Type
    TTE2679 (TyrS)
Mitochondrial biogenesis [BR:tte03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    TTE2679 (TyrS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2575412..2576632)
Genome map
AA seq 406 aa AA seqDB search
MSVLEVLKERGYIAQMTHEEEIEKLLEKEKITFYIGFDPTADSLHVGHLIQIMTMAHMQR
AGHRPIVLLGGGTALIGDPSGRTDMRKMLTKEEIDRNAEAFKKQMERFIDFSEGKAIMEN
NAKWLLGLNYIEFLRDIGVHFTVNRMLEAEAFKTRMERGLTFLEFNYMLMQAYDFLELYR
RYGCVMQMGGNDQWSNIIAGVELIRKKEGKQAYGMTFVLLTTSEGKKMGKTEKGAIWLDP
KKTSPYEFYQYWRNIGDADVEKALALLTFLPMDEVRRLGRLRDKEINEAKKVLAFEVTKL
VHGEEEALKAQKAAEALFEGGGEMEHVPSIEVSQDIIGRKIVDVLFEAKVIPSKSEGRRL
IQQGGLYINDKRVENVDECIKEEMVKENAILVRKGKKEYHRLLVKE
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggtgctagaggttttaaaagaaagaggatatatcgctcaaatgacccatgaagaa
gagatagagaagcttttagaaaaagaaaagataactttttacataggttttgaccccact
gctgacagcctgcacgtaggtcatttgattcagataatgacaatggctcacatgcagaga
gccggccacaggccaattgtgcttttgggaggcggaactgcccttataggagatccgagc
ggtagaactgacatgagaaaaatgctcactaaagaggaaatagatagaaatgctgaagcc
ttcaaaaagcagatggagagattcatcgatttttctgagggcaaagctataatggaaaac
aatgctaaatggctccttggcttgaattacatagaatttttgagagatataggtgttcac
tttactgtaaatcgaatgcttgaggcggaagcttttaagactcgcatggaaagaggcctt
actttccttgagtttaattacatgctaatgcaggcttatgactttttagagctttacagg
cgctatggctgtgtaatgcagatgggaggaaatgatcagtggtctaatataatcgctgga
gtagagcttatacgcaaaaaagaaggcaagcaggcttatggaatgacttttgtgctcctt
acaacaagcgaaggaaagaagatgggcaaaactgaaaaaggcgctatatggctggatcct
aaaaagacttctccttatgaattttatcagtactggagaaatataggagacgcagatgtg
gaaaaggctttggctcttttgactttccttcctatggacgaagtgagaaggcttgggaga
ctaagggataaggagataaacgaagctaaaaaggtactggcttttgaggttacaaagctt
gtacacggtgaagaagaagccctaaaggctcagaaggcggccgaagctctgtttgaaggc
ggcggtgaaatggaacacgtgcccagcattgaagtctctcaggacataatcggaaggaaa
atagttgatgtgctttttgaagctaaagtcataccttcaaagagcgagggaagaaggctt
attcagcagggaggcctttacatcaacgacaagagggtagaaaacgtggatgaatgcata
aaagaagagatggtaaaagaaaatgccattcttgtaagaaaagggaaaaaggaatatcac
aggttattggtaaaggaatga

DBGET integrated database retrieval system