KEGG   Thermus thermophilus HB27: TTC0117Help
Entry
TTC0117           CDS       T00170                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tth  Thermus thermophilus HB27
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TTC0117
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TTC0117
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TTC0117
Enzymes [BR:tth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TTC0117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
103916..104971
Genome map
AA seq 351 aa AA seqDB search
MRPPLIERYRNLLPVSEKTPVISLLEGSTPLIPLKGPEEARKKGIRLYAKYEGLNPTGSF
KDRGMTLAVSKAVEGGAQAVACASTGNTAASAAAYAARAGILAIVVLPAGYVALGKVAQS
LVHGARIVQVEGNFDDALRLTQKLTEAFPVALVNSVNPHRLEGQKTLAFEVVDELGDAPH
YHALPVGNAGNITAHWMGYKAYHALGKAKRLPKMLGFQAAGAAPLVLGRPVERPETLATA
IRIGNPASWQGAVRAKEESGGVIEAVTDEEILFAYRYLAREEGIFCEPASAAAMAGVFKL
LREGRLEPESTVVLTLTGHGLKDPATAERVAELPPPVPARLEAVAAAAGLL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcggccgcccctcatagagcgctaccggaacctcctcccggtctcggagaagacgccg
gtgataagcctcctggagggctccacccccctcatcccccttaagggcccggaggaggcg
aggaagaagggcatccgcctctacgccaagtacgagggcttaaaccccacgggaagcttc
aaggaccgggggatgaccctcgccgtctccaaggcggtggaagggggggcccaggccgtc
gcctgcgccagcaccgggaacaccgccgcctccgccgccgcctacgccgcaagggccggg
attttggccatcgtggtcctccccgcggggtacgtggccttgggcaaggtggcccagagc
ctggtgcacggggcgaggatcgtccaggtggaggggaactttgacgacgccctgcgcctc
acccaaaagctcacggaggccttccccgtggccctggtgaactccgtgaacccccaccgc
ctggagggccagaagaccctggcctttgaggtggtggacgagctcggcgacgccccccac
taccacgccctccccgtggggaacgcggggaacatcaccgcccactggatgggctacaag
gcgtaccacgccctgggcaaggccaaaaggcttcccaagatgctcggcttccaggcggcg
ggggcggcccccttggtcctgggccgcccggtggagcgccccgagaccctggccaccgcc
atccgcatcggcaacccggcgagctggcaaggggccgtgcgggccaaggaggagtcgggg
ggggtcatagaggcggtgacggacgaggagatcctcttcgcctaccgctacctggcccgg
gaggaagggatcttctgcgagcccgcaagcgccgccgccatggcgggggtcttcaagctg
ttgcgggagggtaggcttgagccggagagcaccgtggtcctcaccctcacgggccacggc
ctcaaggacccggctaccgccgagagggtggccgagcttcccccgcccgtgcccgcccgc
ctcgaggccgtggccgcggccgcggggcttttgtga

DBGET integrated database retrieval system