KEGG   Thermus thermophilus HB27: TTC0130Help
Entry
TTC0130           CDS       T00170                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
tth  Thermus thermophilus HB27
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TTC0130
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TTC0130
   00630 Glyoxylate and dicarboxylate metabolism
    TTC0130
Enzymes [BR:tth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     TTC0130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(114756..116318)
Genome map
AA seq 520 aa AA seqDB search
MKGVEIRKDHPLLKEVLTEEALRFVVALHREFNPVRKALLERRQALWERYKAGEKPDFLQ
ETAFVRGGAWRVAEAPPDLLDRRVEITGPVDRKMIINALNSGAKVFMADFEDALSPTWDN
VIRGQKNLYDAVRRQIDFVSPEGKEYKLKEKTATLVVRPRGWHLVEKHVYVDGEPISASL
FDFGLYFFHNAHELLRRGSGPYFYLPKLESHLEARLWNEVFNFAQDYLKIPRGTIRATVL
IETILAAFEMEEILYELKEHAAGLNAGRWDYIFSCIKKFATTAPIFPDRAQVTMTVPFMK
AYTELLVKSCHIHEAHAIGGMAAFIPSRKDPQVNERAFQQVRADKEREASQGFDGTWVAH
PDLVPVAMEVFDRYLGDKPHQKHVKREDVHVTAADLLNFHVPEGRVTEAGLRNNISVALQ
YLNQWLLGNGAAAIFNLMEDAATAEISRAQLWQWVHRGAQLEDGRPVTPDLYQKVKEEEL
AKLGGRDKERYREAEEILDKLVLSEEFVEFLTLVAYDYID
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcgtggagatccggaaagaccaccccctcctgaaggaggtcctgacggaggag
gccctgaggttcgtggtggcgctgcaccgggagttcaacccggtgcgcaaggccctcctg
gagcggcgtcaagcgctttgggagcggtacaaggccggggagaagccggacttcctccag
gagaccgccttcgtccggggcggggcgtggcgggtggccgaggccccgcctgacctcctg
gaccgccgggtggagatcacgggccccgtggaccgcaagatgatcatcaacgccttgaac
tcgggggccaaggtcttcatggcggactttgaggacgccctctcccccacctgggacaac
gtcatccggggtcagaagaacctctatgacgccgtgcgccgccagattgacttcgtctcc
cccgagggcaaggagtacaagctcaaggaaaagacggccaccctggtggtgcgcccaagg
ggctggcaccttgtggaaaagcacgtctacgtggacggggagcccatctcggcgagcctc
tttgacttcggcctctacttcttccacaacgcccacgagctcttaaggcggggaagcggg
ccctacttctacctgcccaagctggaaagccacctcgaggcccgcctctggaacgaggtc
ttcaacttcgcccaggactacctgaagatcccccggggcaccatccgggccacggtcctc
attgagaccatcctggcggcctttgagatggaggagatcctctacgagctcaaggagcac
gccgccgggctcaacgccgggcgctgggactacatcttcagctgcatcaagaagttcgcc
accaccgcccccatcttccccgaccgggcccaggtaacgatgaccgtgcccttcatgaag
gcctacaccgagctcttggtcaagtcctgccacatccacgaggcccacgccatcggcggg
atggcggccttcatcccaagccgcaaggacccccaggtgaacgagcgcgccttccagcag
gtgcgcgcggacaaggaacgggaggcctcccagggctttgacggcacctgggtggcccac
cccgacctggtgcccgtggccatggaggtctttgaccgctacctgggcgacaagccccac
cagaagcacgtgaagcgggaggacgtccacgtgaccgcggcggacctcctgaacttccac
gtccccgaggggagggtgacggaggcggggcttcgcaacaacatctccgtggccctccag
tacctgaaccagtggctcttgggcaacggggccgcggccatcttcaacctcatggaggac
gccgccaccgccgagatcagccgggcccagctctggcagtgggtgcaccggggggcccag
ctggaggacggccgccccgtcacccccgacctctaccagaaggtcaaggaggaggagctc
gccaagctcggcggccgggacaaggagcgctaccgggaggccgaggagatcctggacaag
ctcgtcctctccgaggagttcgtggagttcctgaccctggtggcctacgactacattgac
tga

DBGET integrated database retrieval system