KEGG   Thermus thermophilus HB27: TTC0241Help
Entry
TTC0241           CDS       T00170                                 

Definition
aspartate alpha-decarboxylase (EC:4.1.1.11)
Orthology
K01579  
aspartate 1-decarboxylase [EC:4.1.1.11]
Organism
tth  Thermus thermophilus HB27
Pathway
beta-Alanine metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:tth00410]
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:tth00770]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(228085..228435)
Genome map
AA seq 116 aa AA seqDB search
MFHAKIHRATVTQADLHYVGSVTVDQDLLDAAGILPFEQVDIYDITNGARLTTYALPGER
GSGVIGINGAAAHLVKPGDLVILVAYGVFDEEEARNLKPTVVLVDERNRILEVRKG
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgttccacgccaagatccaccgggccacggtgacccaggccgacctccactacgtgggc
tcggtgacggtggaccaggacctcctggacgccgccgggatccttccttttgagcaggtg
gacatctacgacatcaccaacggggcccggctcaccacctacgcccttcccggggaacgg
gggtccggcgtcatcgggatcaacggggccgcggcccacctggtgaagcccggggacctg
gtcatcctcgtggcctacggcgtctttgacgaggaggaggcgaggaacctcaagcccacc
gtggtcctggtggacgagaggaaccggatcctcgaggtgcgcaaagggtaa

DBGET integrated database retrieval system