KEGG   Thermus thermophilus HB27: TTC0268Help
Entry
TTC0268           CDS       T00170                                 

Gene name
chlI
Definition
magnesium-chelatase subunit chlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
tth  Thermus thermophilus HB27
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tth00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TTC0268 (chlI)
Enzymes [BR:tth01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     TTC0268 (chlI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
257534..259042
Genome map
AA seq 502 aa AA seqDB search
MCLACSSQSRARFTPLLSHAPGEPTAHTPPIPSPRLGRVKAKTLGELRRTYPLEKLRRTV
KDEARENLREKLRRGERLFPGIHGYEDTVIPALVQAILAKQNFILLGTRGQAKSRILRSL
TSLLDEEVPALATELRDNPLHPISPEGRRLLEEAGDDAPIVWLSREDRYVEKLATPDTTV
ADLLGDMDPIKAARRGTGMADLESIHYGLLPRANRGIFAVNELADLAPKVQVALFNILEE
GDVQIRGYPLRLPLDVWLVFTANPQDYTARGRIVTPLKDRIGSEIRTHYPRSLEEGARIS
AQEAYVPEGVLVPEWVRLSVEAVAFVAREDRRVDQTAGVSQRLAISLLEVVAASAERRAL
LHGGRPVARPLDLYQGLPAITGKLELEYEGELQGAERVAREIVQRAFGLVLPRYRLRTEP
IVAHFEEGNLLTLPEGDVEEALKAMAGVPGLLEAARALAEGEAPEVLLSAGEFVLEGLVG
RRKLSRGEASYQAAERPRSYGN
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
ttgtgcctcgcctgctccagccagtcccgggcccggttcacccccttattatcccacgcc
ccaggggaacccacggcacacaccccgcctatcccttcccctagactgggaagggtgaag
gccaagaccctaggcgaactcaggcgcacctaccccctggagaagctccgccgcaccgtg
aaggacgaggccagggagaacctccgggagaagctcaggcgcggggagaggcttttcccc
ggcatccacggctacgaggacacggtgatccccgccctggtccaggccatcctcgccaag
cagaacttcatcctcctcggcacccggggccaggcgaaaagccggatcctgcggagcctc
acgagcctcctggacgaggaggttcccgccctcgccacggagcttcgcgacaaccccctc
caccccatctcccccgagggaaggcgcctcctggaggaggccggggacgacgcccccatc
gtctggctttcccgggaggaccggtacgtggagaagctcgccacccccgacaccaccgtg
gccgacctcctcggggacatggaccccatcaaggcggccaggcggggcacggggatggcg
gacctggagagcatccactacggcctcctgccccgggcgaaccgggggatcttcgccgtg
aacgagctcgccgacctcgcccccaaggtgcaggtggccctcttcaacatcctcgaggag
ggggacgtccagatccggggctaccccctccggcttcccctggacgtctggctcgtcttc
accgccaacccccaggactacaccgcccggggccgcatcgtgacccccctcaaggaccgg
atcgggagcgagatccgcacccactacccccgctccttggaggagggggcccggatcagc
gcccaggaggcctacgtgccggagggggtcctggtcccggagtgggtgaggctttccgtg
gaggccgtggccttcgtcgcccgggaggaccgccgcgtggaccagacggcgggggtctcc
cagcgcctcgccatcagccttttggaggtggtggcggcaagcgccgagcgccgcgccctc
ctccacgggggaaggcccgtggcgaggcctttggacctctaccaggggcttcccgccatc
accgggaagctggaattggagtacgagggggagctccagggggcggagagggtggcgcgg
gagatcgtgcagcgggccttcggcctggtcctcccccgctaccgcttaaggaccgagccc
atcgtggcccactttgaggagggaaacctcctcaccctgcccgagggggacgtggaggag
gcccttaaggccatggccggggtcccggggcttctggaggcggcgagggccctggccgag
ggggaagcccctgaggttttgctttccgccggggagttcgtcctcgagggcctggtgggg
cggcggaagctctcccggggcgaggcgagctaccaggcggcggagcgcccgaggagctat
ggcaactag

DBGET integrated database retrieval system