KEGG   Thermus thermophilus HB27: TTC0370Help
Entry
TTC0370           CDS       T00170                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
tth  Thermus thermophilus HB27
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:tth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TTC0370 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    TTC0370 (hisD)
Enzymes [BR:tth01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     TTC0370 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
354833..356071
Genome map
AA seq 412 aa AA seqDB search
MIYAAEEVRARFARRGLSFDPTVEEIVRGILEAVREEGDEALDRFSRDLDGYPVEEVPKR
AWREAYEDLDEDLRDALETARERIEAFYREEARGGFLRAEGGGVLAQLVRPLERVGVYVP
GGSAPLLSTLLMTVVPAKVAGVREVIVASPPKVHPGVLAAAWVAGADRLFAMGGAQAIAA
LAYGTGRVPRVDKIVGPGNRYVVAAKRLVYGTVGIDGLAGPTETMIIADGSASPRLLAAD
LLAQAEHGPDSEPWLLSPDRALLERVEAELSRQLQDLPRAEVARQALEKGGLVLTKDLEE
AFALANLYAPEHLSLALSDPLPWLEKVQNAGGVFLGEGSPEALGDYIAGPSHVMPTSGTA
RFQGGLAVRDFLKVIPVVGLSEGAARELAKKGALLARAEGLEGHARSLDLRR
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgatctacgctgccgaggaggtgcgggcccgcttcgcccgccggggcctctcctttgat
cccacggtggaggagatcgtgcggggcatcctggaggcggtccgggaggaaggggacgag
gccctggaccggttcagccgggacctggacggctacccggtggaggaggtccccaagcgg
gcctggcgggaggcctacgaggacttggacgaggacctcagggatgccctggagacggcc
cgggagcgcatagaggccttctaccgggaggaggcccggggcggcttcctccgggccgag
gggggcggggtgctggcccagctcgtccgccccctggagcgggtgggggtctacgtcccc
gggggaagcgcccccctcctctccaccctcctcatgaccgtggtcccggccaaggtggcg
ggggtgcgggaggtgatcgtggcgagcccccccaaggtccaccccggggtcctggccgcc
gcctgggtggcgggggccgaccgcctcttcgccatgggcggggcccaggccatcgccgcc
ctggcctacggcacggggcgcgtcccccgggtggacaagatcgtggggccggggaaccgc
tacgtggtggcggcgaagaggctcgtctacggcaccgtgggcattgacggcctcgccggc
cccacggagaccatgatcatcgccgacggctccgcctcccccaggctcctcgccgccgac
cttctcgcccaggcggagcacggccccgactccgagccctggctcctctccccggaccgg
gccctgttggaacgggtggaggccgagctttcccggcagctccaggacctcccccgggcc
gaggtggcccgccaggccctggagaagggcgggctcgtcctcaccaaggacctggaggag
gccttcgccctcgccaacctctacgcccccgagcacctctccctcgccctctcggacccc
cttccctggctggagaaggtgcagaacgccgggggggtcttcctgggggaggggagcccc
gaggccttgggcgactacatcgccgggcccagccacgtcatgcccacctcggggacggcc
cgcttccagggggggttggcggtgcgggacttcctgaaggtgatcccggtggtgggcctt
tccgagggcgcggcccgggagctcgccaagaagggggcgcttttggcccgggcggagggc
ctcgagggccacgcccgctccctggacctcaggcgatga

DBGET integrated database retrieval system