KEGG   Thermus thermophilus HB27: TTC0427Help
Entry
TTC0427           CDS       T00170                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tth  Thermus thermophilus HB27
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tth00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tth00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(416394..417302)
Genome map
AA seq 302 aa AA seqDB search
MRHLLDFQGWSRTEVESLLDTARVMREVLERPIKKVPALQGFTVATVFFEPSTRTRISFE
LAARRMSADVVSFAAQTSSLQKGESYKDTLLTLEAMGVDAYVIRADSAGVPHQATRWVKG
AVINGGDGRRAHPTQALLDAYTLLEALGTLEGKKVAIVGDILHSRVARSGAELLSLLGAQ
VFCAGPPSLLPQSLPGAHLTPRLEEALEEADAVMVLRLQKERMEAGLVHLEDYVARYQVT
EKRLALAKPQAPLLHPGPMNRDVELEGTLADSARSLVNRQVQNGVAVRMAVLYHLLVGRE
KA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaggcacctcctggacttccagggctggagcaggaccgaggtggagagccttctggac
accgcccgggtgatgcgggaggtcctggagcggcccataaagaaggtccccgccctccag
ggcttcaccgtggccacggtcttctttgagccctccacccgcacccgcatctcctttgag
ctcgccgcccggcgcatgtccgcggacgtggtctccttcgccgcccaaacgagcagcctc
cagaagggggaaagctacaaggacaccctcctcaccctcgaggccatgggggtggacgcc
tacgtcatccgggcggacagcgccggcgtgccccaccaggccacccgctgggtcaagggg
gccgtgatcaacgggggggacgggcgccgcgcccaccccacccaggccctcctggacgcc
tacaccctcctcgaggccctgggtaccctggagggcaagaaggtcgccatcgtgggggac
atccttcactcccgggtggcccgctcgggcgccgagctcctctccctcctcggggcccag
gtcttctgcgccggccccccgagcctcctcccccaaagcctccccggagcccacctcacc
ccccgtctggaggaggccctggaggaggcggacgccgtcatggtcctcaggctccagaag
gagcggatggaggcggggctcgtccacctcgaggactacgtcgcccgctaccaggtgacg
gaaaagcgcctcgccctggccaagccccaagcccccctcctccaccccggccccatgaac
cgggacgtggagctggaggggaccttggcggactcggcgaggagcctggtgaaccgacag
gtgcaaaacggggtggcggtgcgcatggcggtgctctaccacctcctggtggggagggag
aaagcatga

DBGET integrated database retrieval system