KEGG   Thermus thermophilus HB27: TTC0730Help
Entry
TTC0730           CDS       T00170                                 

Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tth  Thermus thermophilus HB27
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TTC0730
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TTC0730
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TTC0730
Enzymes [BR:tth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TTC0730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(713754..715010)
Genome map
AA seq 418 aa AA seqDB search
MGVVLARGAFRERSMLTLPDFPLPDARGRFGPYGGRYVPETLIPALEELEAAYREAKKDP
AFLEELDHYLRQFAGRPTPLYHAKRLSEYWGGAQVFLKREDLLHTGAHKINNTLGQALLA
RRMGKRRVIAETGAGQHGVSVATVAALFGLECVVYMGEEDVRRQALNVFRMKLLGAEVRP
VAAGSRTLKDATNEAIRDWITNVRTTFYILGSVVGPHPYPMMVRDFQSVIGEEVKRQSLE
LFGRLPDALIAAVGGGSNAIGLFAPFAYLPEGRPKLIGVEAAGEGLSTGRHAASIGAGKR
GVLHGSYMYLLYDHDGQITPAHSVSAGLDYPGVGPEHSYYADAGVAEYASVTDEEALEGF
KLLARLEGIIPALESAHAIAYAAKVVPEMDKDQVVVINLSGRGDKDVTEVMRLLGGEL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgggagttgtcttggcgcgaggcgcctttagggagcgaagcatgctgaccctacccgac
tttcccttgcccgacgcgagggggcggttcggcccctacggggggcggtacgtgcccgag
accctgatccccgccctggaggagttggaggccgcctaccgggaggccaagaaggatccg
gccttcctggaggagctggaccactacctcaggcagtttgccggcaggcccacgcccctt
taccacgccaagcggctttccgagtactggggtggggcccaggtcttcctcaagcgggag
gacctcctccacaccggggcccacaagatcaacaacaccctgggccaagccctcctggcg
aggcgcatgggcaagaggcgggtcatcgccgaaacgggggcggggcagcacggggtgagc
gtggccacggtggcggccctcttcggcctggagtgcgtggtctacatgggggaggaggac
gtcaggcgccaggccttaaacgtcttccgcatgaagctcctcggggccgaggtccggccc
gtggccgcggggagccgcaccctcaaggacgccaccaacgaggccatccgcgactggatc
acgaacgtgcgcaccaccttctacatcctgggctccgtggtgggcccccacccctacccc
atgatggtccgggacttccagagcgtcatcggggaggaggtgaagcggcaaagcctggag
cttttcggccgcctgcccgacgccctcatcgccgcggtggggggcggttccaacgccatc
ggcctcttcgcccccttcgcctacctgcctgagggcaggcccaagctcatcggggtggag
gccgccggggaggggctttccacgggcaggcacgccgcgagcatcggggcggggaagcgg
ggggtgctgcacgggagctacatgtacctcctctacgaccacgatgggcagatcaccccg
gcccactccgtctccgcagggctggactaccccggggtggggccggagcacagctactac
gccgacgccggggtggcggagtacgccagcgtcacggacgaggaggccctcgagggcttc
aagctcctggcgcggcttgagggcatcatccccgccttggagtcggcccacgccatcgcc
tacgccgccaaggtggtgccggagatggacaaggaccaggtggtggtcatcaacctctcc
ggccggggggacaaggacgtgaccgaggtgatgcgccttctgggaggggagctgtga

DBGET integrated database retrieval system