KEGG   Thermus thermophilus HB27: TTC0886Help
Entry
TTC0886           CDS       T00170                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tth  Thermus thermophilus HB27
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TTC0886
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTC0886
   00620 Pyruvate metabolism
    TTC0886
   00640 Propanoate metabolism
    TTC0886
  Energy metabolism
   00680 Methane metabolism
    TTC0886
Enzymes [BR:tth01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TTC0886
Lipid biosynthesis proteins [BR:tth01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TTC0886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
861144..863027
Genome map
AA seq 627 aa AA seqDB search
MALEKLLKVQERLWAPEDLRKKANLQDYAAEYRKSLEDPEGFWGAWARRFHWEKPFEKVL
EWTLPEHRWFLGGTTNAVYNALERNVERGLRNKVALLYLAEDGREEKLTYGELLDRVRRL
ATGLRRLGVGKGDRVVIYMPLTLEGVLAMLATAYIGAIHSVVYAGLGVSALRERILDAQA
KLLIAGDVSFRRGKGVDLRSIAEEAIRDLPLKVVWFQRAYKAELSEGHYDFHELLWGNPP
EARAEMVDAEHPLFILYTSGSTGKPKGVVHVHGGYMVGTTYHLRTFFDVKDEDVFWATSD
IGWIVGHSYIVYAPLLEGITSVLREGAPDHPDPGALWQAVERYRVNVMFTAPTAVRMFMK
YGPEWPRKYDLSSLRLLAVAGEPLNPEALKWAYEHLVDGGRRGFVADNWWQTELGGPTLG
TPLTLPAKPGFAGVALPGVEAEVVDEEGRPVPPGQGGLLVLKRPFPHMMRTVWGNHERYL
RYWQEVPGGVYASGDVASKDEEGYFSVLGRADDVLNVAGHRIGTADVESALVSHPAVAEA
AVIGVPDPLKGEAIKAFVVLRLGQTPSEELKEALVQHVRRELGPIATPSEVVFLDKLPKT
RSGKILRRLLKAQALGKDPGDLSTLEE
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggaaaagctccttaaggttcaggaaaggctttgggcaccggaggacttgcgg
aagaaggcgaacctccaggactacgcggcggagtaccggaagagcctcgaggaccccgag
ggcttctggggggcttgggcgcggcgcttccactgggaaaagccctttgagaaggtcctt
gagtggaccctcccagagcaccgctggttcctgggcggcaccaccaacgccgtttacaac
gccctggagcggaacgtggaaaggggcctaaggaacaaggtggccctcctctacctcgcc
gaggacggccgggaggaaaagctcacctacggggagcttctggaccgggtgcgccgcctg
gccacggggcttaggcgcctcggggtgggaaagggggaccgggtggtgatctacatgccc
ctcaccctggaaggggtcctcgccatgctcgccaccgcctacatcggcgccatccacagc
gtggtctacgccgggcttggggtctcggccctgagggagcgcatcctggacgcccaggcc
aagctcctcatcgccggggacgtaagcttccggcgggggaagggggtggacctcaggagc
atcgccgaggaggccatccgggaccttcccctaaaagtggtctggttccagcgggcgtac
aaggcggagctttccgaagggcactacgacttccacgagctcctctggggtaaccccccc
gaggcccgggcggagatggtggacgccgagcaccccctcttcatcctctacacctcgggc
tccacgggaaagcccaagggcgtggtccacgtccacggggggtacatggtgggcaccacc
taccacctgcgcaccttctttgacgtgaaggacgaggacgtcttctgggccacgagcgac
atcggctggatcgtgggccactcctacatcgtctacgccccccttcttgaggggatcacc
tccgtcctccgggaaggggcccccgaccaccccgaccccggggccctctggcaggcggtg
gagcggtaccgggtgaacgtgatgttcaccgcccccacggcggtgcgcatgttcatgaag
tacggccccgagtggcccaggaagtacgacctcagctccttgcgccttctggccgtggcc
ggggagcccttgaaccccgaggccctgaagtgggcctacgagcacctggtggacgggggc
aggcggggcttcgtggcggacaactggtggcagacggagctcggcggccccaccctggga
acccccctcaccctccccgccaagcccggcttcgccggggtggccctccccggggtggag
gcggaggtggtggacgaggagggcaggcccgtccccccggggcagggcggcctcctcgtc
ctcaagcggcccttcccccacatgatgcgcaccgtctgggggaaccacgagcgctacctc
cggtactggcaggaggtcccggggggcgtctacgccagcggggacgtggcgagcaaggac
gaggaggggtacttcagcgtcttgggccgggcggacgacgtgctgaacgtcgcggggcac
cgcatcggtaccgccgacgtggaaagcgccctggtctcccaccccgccgtggccgaggcc
gcggtcatcggcgtccccgaccccctgaagggggaggccatcaaggccttcgtggtcctt
aggcttgggcaaaccccctccgaggagctgaaggaggccctcgtccagcacgtgcgccgg
gagctcgggcccatcgccacgccgagcgaggtggtcttcctggacaagctccccaagacc
cgctcggggaagatcctgaggcggctcctcaaggcccaggccctgggcaaggaccccggg
gacctctccaccctcgaggagtag

DBGET integrated database retrieval system