KEGG   Thermus thermophilus HB27: TTC0965Help
Entry
TTC0965           CDS       T00170                                 

Definition
glutamine synthetase (EC:6.3.1.2)
Orthology
K01915  
glutamine synthetase [EC:6.3.1.2]
Organism
tth  Thermus thermophilus HB27
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Glyoxylate and dicarboxylate metabolism
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Two-component system
Brite
KEGG Orthology (KO) [BR:tth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TTC0965
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TTC0965
  Energy metabolism
   00910 Nitrogen metabolism
    TTC0965
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TTC0965
   00330 Arginine and proline metabolism
    TTC0965
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    TTC0965
Enzymes [BR:tth01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamate---ammonia ligase
     TTC0965
Exosome [BR:tth04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TTC0965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
945901..947241
Genome map
AA seq 446 aa AA seqDB search
MGYTKAEILKALKGENVKFLRLQITDILGVVKNVEVPESQFEKALDGEIMFDGSSIEGFT
RIEESDMLLRPDYNTFVILPDLVEDPKRGRVARLICDVYYPDGRPFEGDPRYVLKRQIER
LKKLGFDNLYAGPEPEFFLFLRTPEGLPTTETHDRAGYFDLAPIDKGEEARRDMVNALVA
MGFEIEAAHHEVAPGQHEIDFKYADALTTADNIATFKWVVKRIALNHGLHATFLPKPIRG
INGSGMHTHLSLFKDGENAFYDPNAEYQLSQTALHFIAGLLEHAAGMVAVTNPLVNSYKR
LTPGYEAPTNIAWSASNRSAMIRIPARRGVGTRAELRMPDPSCNPYLALAVMAAAGADGI
ERKLLPPPPIQRNIYQMTVRERRKHKIRELPGTLREALEALRKDPVIREALGEHVYTHFL
QAKQMEWDDYRVTVHQWELDRYLATY
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgggttacacgaaggccgagattttaaaagcgcttaagggggaaaacgtcaagttcttg
cgcctgcagatcacggacatcctgggcgtggtcaagaacgtggaggtgcccgagtcccag
tttgagaaggccctggacggggagatcatgtttgacggctcctccattgagggcttcacc
cggattgaggagtcggacatgctcctaaggcccgactacaacaccttcgtcatcctcccc
gacctggtggaagacccaaagcggggccgggtggcgcggctcatctgcgacgtctactac
cccgacggccgcccctttgaaggggacccccgctacgtcctcaagcggcagattgaaagg
ctcaagaagctcgggtttgacaacctgtacgccggccccgagcccgagttcttcctcttc
ctcaggaccccggagggcctgcccaccaccgagacccacgaccgggcgggctactttgac
ctggcccccatagacaagggggaggaggcgcgccgcgacatggtgaacgccctggtggcc
atgggctttgagattgaggcggcccaccacgaggtggccccggggcagcacgagattgac
ttcaagtacgccgacgccctcaccaccgccgacaacatcgccaccttcaagtgggtggtg
aagcggatcgccctgaaccacggcctccacgccaccttcctgcccaagcccatccggggc
atcaacggcagcggcatgcacacccacctctccctcttcaaggacggggagaacgccttc
tatgaccccaacgccgagtaccagctctcccagaccgccctccacttcatcgctgggctc
ctggagcacgccgccgggatggtggccgtcaccaaccccttggtgaactcctacaagcgc
ctcacccccgggtacgaggcccccaccaacatcgcctggtccgcctccaaccgctccgcc
atgatccggatcccggcgcgccggggcgtgggcacccgggcggagctcaggatgcccgac
ccctcctgcaacccctacctggccctggcggtgatggcggccgcgggcgcggacgggatt
gagcggaagctcctcccgcccccgcccatccagcggaacatctaccagatgaccgtgcgg
gagcggcgcaagcacaagatccgggagctccccgggaccctccgggaggccctcgaggcc
ctgaggaaggaccccgtgatccgggaggccctgggcgagcacgtctacacccacttcctc
caggccaagcagatggagtgggacgactaccgggtcacggtccaccagtgggagctggac
cggtacctggccacctactag

DBGET integrated database retrieval system