KEGG   Thermus thermophilus HB27: TTC1132Help
Entry
TTC1132           CDS       T00170                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
tth  Thermus thermophilus HB27
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TTC1132
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TTC1132
Enzymes [BR:tth01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     TTC1132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1100717..1101619)
Genome map
AA seq 300 aa AA seqDB search
MDVSATMPPMERVAVVGVPMDLGANRRGVDMGPSALRYARLLEQLEDLGYTVEDLGDVPV
SLARASRRRGRGLAYLEEIRAAALVLKERLAALPEGVFPIVLGGDHSLSMGSVAGAARGR
RVGVVWVDAHADFNTPETSPSGNVHGMPLAVLSGLGHPRLTEVFRAVDPKDVVLVGVRSL
DPGEKRLLKEAGVRVYTMHEVDRLGVARIAEEVLKHLQGLPLHVSLDADVLDPTLAPGVG
TPVPGGLTYREAHLLMEILAESGRVQSLDLVEVNPILDERNRTAEMLVGLALSLLGKRIF
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggacgtttctgctaccatgccccccatggaacgcgtggccgtggtgggcgtgcccatg
gacctgggggcgaaccggcggggcgtggacatggggccgtccgccctgcggtacgcccgg
cttctggagcagctggaggatctgggctacaccgtggaggacctgggggacgtgcccgtc
tccttggcccgggcctcgaggcgaagggggcggggcctcgcctacctggaggagatccgg
gccgcggccctcgtcctaaaggagcgccttgcggccctgcccgagggggttttccccatc
gtcttgggcggggaccactccttgagcatgggctccgtggcgggggccgcccggggccgg
cgggtgggcgtggtctgggtggacgcccacgccgacttcaacacccccgagacctcgccg
agcggcaacgtccacggcatgcccctcgccgtcctctcgggcctgggccatccccggctc
acggaggtcttccgggccgtggaccccaaggacgtggtcctggtgggggtgcggagcctg
gaccccggggagaagcggctccttaaggaggcgggggtccgggtctacaccatgcacgag
gtggaccgcctcggcgtggcccggatcgccgaggaggttctaaagcacctccagggcctc
cccctccacgtctccctggacgccgacgtcctggaccccaccctcgcccccggggtgggg
accccggtgcccggggggctcacttaccgggaggcgcacctcctcatggagatcctggcc
gagtcgggccgggtgcagagcctggacctggtggaggtgaaccccatcctggacgagcgc
aaccgcaccgccgagatgctggtgggcctggcgctaagcctcttgggcaagcggatcttt
tag

DBGET integrated database retrieval system